SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaFAMAMG14935_5prime_partial:A_TrvaFAMAMG_TR11931c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_laminin_subunit_alpha-2_[Bombyx_mori]
Ontology
GO:0002011 P morphogenesis of an epithelial sheet
GO:0005102 F signaling receptor binding
GO:0005201 F extracellular matrix structural constituent
GO:0005515 F protein binding
GO:0005576 C extracellular region
GO:0005578 C extracellular matrix
GO:0005604 C basement membrane
GO:0005605 C basement membrane
GO:0005606 C laminin-1 complex
GO:0005608 C laminin-3 complex
GO:0005615 C extracellular space
GO:0005911 C cell-cell junction
GO:0006468 P protein phosphorylation
GO:0007155 P cell adhesion
GO:0007166 P cell surface receptor signaling pathway
GO:0007411 P axon guidance
GO:0009888 P tissue development
GO:0022617 P extracellular matrix disassembly
GO:0030155 P regulation of cell adhesion
GO:0030198 P extracellular matrix organization
GO:0030334 P regulation of cell migration
GO:0031012 C extracellular matrix
GO:0031175 P neuron projection development
GO:0043208 F glycosphingolipid binding
GO:0043256 C laminin complex
GO:0045198 P establishment of epithelial cell apical/basal polarity
GO:0045995 P regulation of embryonic development
GO:0060041 P retina development in camera-type eye
GO:0060441 P epithelial tube branching involved in lung morphogenesis
GO:0060445 P branching involved in salivary gland morphogenesis
GO:0061304 P retinal blood vessel morphogenesis
RNA-seq EntryA_TrvaFAMAMG_TR11931c0_g1_i1
Sequence
(Amino Acid)
GVPACVHALRSAGKPLGLWRTVLQPREAACTGCTHRWMSSGRGDSMTWFNGAGYVELRRS
RVRPVDTRYFSIAFTFQTMDENALLFMATDDANNRSVSIVMRSCRVYFEVQYSGARLELV
APGRHCDGRPAHLQAIRAFAHNDLEKVCV
*(49 a.a.)

- SilkBase 1999-2023 -