SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG14861_complete:A_TrvaFAMAMG_TR11892c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		vacuolar_protein_sorting_4_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000920 P septum digestion after cytokinesis
GO:0000922 C spindle pole
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005768 C endosome
GO:0005813 C centrosome
GO:0005829 C cytosol
GO:0006810 P transport
GO:0006813 P potassium ion transport
GO:0006997 P nucleus organization
GO:0007032 P endosome organization
GO:0007033 P vacuole organization
GO:0007049 P cell cycle
GO:0007080 P mitotic metaphase plate congression
GO:0008022 F protein C-terminus binding
GO:0008568 F microtubule-severing ATPase activity
GO:0010008 C endosome membrane
GO:0010824 P regulation of centrosome duplication
GO:0010971 P positive regulation of G2/M transition of mitotic cell cycle
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016197 P endosomal transport
GO:0016787 F hydrolase activity
GO:0016887 F ATP hydrolysis activity
GO:0019076 P viral release from host cell
GO:0030301 P cholesterol transport
GO:0031122 P cytoplasmic microtubule organization
GO:0031902 C late endosome membrane
GO:0032510 P endosome to lysosome transport via multivesicular body sorting pathway
GO:0033993 P response to lipid
GO:0036258 P multivesicular body assembly
GO:0039702 P viral budding via host ESCRT complex
GO:0042623 F ATP hydrolysis activity
GO:0042802 F identical protein binding
GO:0042803 F protein homodimerization activity
GO:0043162 P ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
GO:0048524 P positive regulation of viral process
GO:0050792 P regulation of viral process
GO:0051261 P protein depolymerization
GO:0051301 P cell division
GO:0060548 P negative regulation of cell death
GO:0061738 P late endosomal microautophagy
GO:0070062 C extracellular exosome
GO:0090543 C Flemming body
GO:0090611 P ubiquitin-independent protein catabolic process via the multivesicular body sorting pathway
GO:1901673 P regulation of mitotic spindle assembly
GO:1902188 P obsolete positive regulation of viral release from host cell
GO:1903542 P negative regulation of exosomal secretion
GO:1903543 P positive regulation of exosomal secretion
GO:1903724 P positive regulation of centriole elongation
GO:1903902 P positive regulation of viral life cycle
RNA-seq EntryA_TrvaFAMAMG_TR11892c0_g1_i1
Sequence
(Amino Acid)
MQGVGNDMDGILVLGATNIPWVLDSAIRRRFEKRIYIALPEEHARLVMFKLHLGNTRHQL
TEQDLKLLATKSDGYSGADISIVVRDALMQPVRKVQSATHFKKVTGPSPTDPNVIVNDLL
TPCSPGDPGAIEMTWIDVPSDKLGEPPVTMSDMLRSLAVSKPTVNDDDMVKLRKFMEDFG
QEG
*(60 a.a.)

- SilkBase 1999-2023 -