SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG14830_3prime_partial:A_TrvaFAMAMG_TR11859c1_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_uncharacterized_protein_LOC101746142_[Bombyx_mori]
Ontology
GO:0000209 P protein polyubiquitination
GO:0001894 P tissue homeostasis
GO:0003713 F transcription coactivator activity
GO:0003723 F RNA binding
GO:0004842 F ubiquitin-protein transferase activity
GO:0005515 F protein binding
GO:0005622 C intracellular anatomical structure
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005863 C striated muscle myosin thick filament
GO:0007014 P actin ubiquitination
GO:0008270 F zinc ion binding
GO:0009411 P response to UV
GO:0016567 P protein ubiquitination
GO:0016874 F ligase activity
GO:0017022 F myosin binding
GO:0030307 P positive regulation of cell growth
GO:0030335 P positive regulation of cell migration
GO:0030957 F Tat protein binding
GO:0031369 F translation initiation factor binding
GO:0032479 P regulation of type I interferon production
GO:0032897 P negative regulation of viral transcription
GO:0034612 P response to tumor necrosis factor
GO:0042787 P ubiquitin-dependent protein catabolic process
GO:0043123 P positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0043130 F ubiquitin binding
GO:0043621 F protein self-association
GO:0045087 P innate immune response
GO:0045444 P fat cell differentiation
GO:0045666 P positive regulation of neuron differentiation
GO:0045732 P positive regulation of protein catabolic process
GO:0045787 P positive regulation of cell cycle
GO:0045862 P positive regulation of proteolysis
GO:0046716 P muscle cell cellular homeostasis
GO:0046872 F metal ion binding
GO:0048147 P negative regulation of fibroblast proliferation
GO:0050769 P positive regulation of neurogenesis
GO:0051091 P positive regulation of DNA-binding transcription factor activity
GO:0051092 P positive regulation of NF-kappaB transcription factor activity
GO:0051155 P positive regulation of striated muscle cell differentiation
GO:0061564 P axon development
GO:0061630 F ubiquitin protein ligase activity
GO:1902187 P suppression of viral release by host
GO:1902230 P negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage
GO:1903265 P positive regulation of tumor necrosis factor-mediated signaling pathway
GO:1903883 P positive regulation of interleukin-17-mediated signaling pathway
GO:1903886 P positive regulation of chemokine (C-C motif) ligand 20 production
GO:2000147 P positive regulation of cell motility
RNA-seq EntryA_TrvaFAMAMG_TR11859c1_g1_i1
Sequence
(Amino Acid)
MSRFLLADLEDMVRCPWCMHPFDETQRAPKLLSCRHHFCLRCTQTVLAPGLGFDVFCVLC
EIHTPVPGGRAEALPTHAGLRALARLLSPAPPCAAHQQPALWCVTCEQRAC
(36 a.a.)

- SilkBase 1999-2023 -