SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG14825_3prime_partial:A_TrvaFAMAMG_TR11856c1_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_ryanodine_receptor_44F_isoform_X4_[Bombyx_mori]
Ontology
GO:0005216 F ion channel activity
GO:0005219 F ryanodine-sensitive calcium-release channel activity
GO:0005262 F calcium channel activity
GO:0005789 C endoplasmic reticulum membrane
GO:0005875 C microtubule associated complex
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006816 P calcium ion transport
GO:0006874 P cellular calcium ion homeostasis
GO:0006936 P muscle contraction
GO:0007275 P multicellular organism development
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016529 C sarcoplasmic reticulum
GO:0033017 C sarcoplasmic reticulum membrane
GO:0035206 P regulation of hemocyte proliferation
GO:0051209 P release of sequestered calcium ion into cytosol
GO:0055085 P transmembrane transport
GO:0060047 P heart contraction
GO:0070588 P calcium ion transmembrane transport
GO:0072347 P response to anesthetic
RNA-seq EntryA_TrvaFAMAMG_TR11856c1_g1_i1
Sequence
(Amino Acid)
MAEAEGGASEQDDVSFLRTEDMVCLSCTATGERVCLAAEGFGNRHCFLENIADKNIPPDL
SQCVFVIEQALSVRALQELVTAAGSETGKGTGSGHRTLLYGNAILLRHLNSDMYLACLST
SSSQDKLAFDVGLQEHSQGEACWWTLHPASKQRSEGEKVRVGDDLILVSVGTERY
(57 a.a.)

- SilkBase 1999-2023 -