SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaFAMAMG14748_3prime_partial:A_TrvaFAMAMG_TR11815c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_frizzled-4_[Bombyx_mori]
Ontology
GO:0001553 P luteinization
GO:0001568 P blood vessel development
GO:0001570 P vasculogenesis
GO:0004871 F obsolete signal transducer activity
GO:0004888 F transmembrane signaling receptor activity
GO:0004930 F G protein-coupled receptor activity
GO:0005575 C cellular_component
GO:0005886 C plasma membrane
GO:0005911 C cell-cell junction
GO:0007165 P signal transduction
GO:0007166 P cell surface receptor signaling pathway
GO:0007186 P G protein-coupled receptor signaling pathway
GO:0007223 P Wnt signaling pathway, calcium modulating pathway
GO:0007275 P multicellular organism development
GO:0007605 P sensory perception of sound
GO:0008150 P biological_process
GO:0009986 C cell surface
GO:0010812 P negative regulation of cell-substrate adhesion
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016055 P Wnt signaling pathway
GO:0017147 F Wnt-protein binding
GO:0019955 F cytokine binding
GO:0030165 F PDZ domain binding
GO:0030947 P regulation of vascular endothelial growth factor receptor signaling pathway
GO:0031625 F ubiquitin protein ligase binding
GO:0031987 P locomotion involved in locomotory behavior
GO:0034446 P substrate adhesion-dependent cell spreading
GO:0035426 P extracellular matrix-cell signaling
GO:0035567 P non-canonical Wnt signaling pathway
GO:0042701 P progesterone secretion
GO:0042803 F protein homodimerization activity
GO:0042813 F Wnt-activated receptor activity
GO:0043507 P positive regulation of JUN kinase activity
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0046982 F protein heterodimerization activity
GO:0051091 P positive regulation of DNA-binding transcription factor activity
GO:0060070 P canonical Wnt signaling pathway
GO:0061299 P retina vasculature morphogenesis in camera-type eye
GO:0061301 P cerebellum vasculature morphogenesis
GO:0061304 P retinal blood vessel morphogenesis
GO:0070062 C extracellular exosome
RNA-seq EntryA_TrvaFAMAMG_TR11815c0_g1_i1
Sequence
(Amino Acid)
MLSFIAIIFSVSLVPFATAEASVRTCEPIKVAMCKNIGYNQTGMPNLARHTLQADADVTL
QTFSPLVQYGCSSQLHLFLCSVYVPMCTDKVALPIGPCRGLCESVYARCFPVLRGFGFPW
PPELDCSLFPAENNHEHMCMEGPGERAPPVGTIPLDATGACRRLIKPNSWVWVRGSSRCA
QFCDAEVLWESGERRAAEVWLATWAALSFACTLAAVAAQLACGDRGGAGERALVLVALCR
CAAAAGWGVRAAAGRAAAGCAKESTTP
(88 a.a.)

- SilkBase 1999-2023 -