SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG14592_5prime_partial:A_TrvaFAMAMG_TR11770c0_g3_i1
Scaffold_id
NCBI non-redundant
(nr)		putative_Zinc_finger_protein_91_[Danaus_plexippus]
Ontology
GO:0003676 F nucleic acid binding
GO:0005622 C intracellular anatomical structure
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005694 C chromosome
GO:0006311 P meiotic gene conversion
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007283 P spermatogenesis
GO:0008168 F methyltransferase activity
GO:0010844 F recombination hotspot binding
GO:0010845 P positive regulation of reciprocal meiotic recombination
GO:0016568 P chromatin organization
GO:0016571 P histone methylation
GO:0016740 F transferase activity
GO:0018024 F histone-lysine N-methyltransferase activity
GO:0032259 P methylation
GO:0034968 P histone lysine methylation
GO:0042800 F histone methyltransferase activity (H3-K4 specific)
GO:0043565 F sequence-specific DNA binding
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0051321 P meiotic cell cycle
GO:0051568 P histone H3-K4 methylation
GO:0060903 P positive regulation of meiosis I
RNA-seq EntryA_TrvaFAMAMG_TR11770c0_g3_i1
Sequence
(Amino Acid)
KPYQCKLCAATFPKLRAITQHFKHVHLRQRRKTFACRICGKQLTPRRQALHLDKEHNIPA
PTCGCCGRKFAFQNLLLHHQKTYHMGEKDFICPECGKGFDRATTLRKHQRSHSNLRPHTC
NVCSKSFKCKSNLKVHEAIHAEEKKYSCHICGMGFTQKTSLNYHFNKRHPNES
*(57 a.a.)

- SilkBase 1999-2023 -