SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaFAMAMG14568_3prime_partial:A_TrvaFAMAMG_TR11762c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_uncharacterized_protein_LOC101743538_[Bombyx_mori]
Ontology
GO:0000077 P DNA damage checkpoint signaling
GO:0000166 F nucleotide binding
GO:0000723 P telomere maintenance
GO:0000724 P double-strand break repair via homologous recombination
GO:0000781 C chromosome, telomeric region
GO:0001666 P response to hypoxia
GO:0001756 P somitogenesis
GO:0002331 P pre-B cell allelic exclusion
GO:0003677 F DNA binding
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004677 F DNA-dependent protein kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005819 C spindle
GO:0006281 P DNA repair
GO:0006468 P protein phosphorylation
GO:0006915 P apoptotic process
GO:0006974 P cellular response to DNA damage stimulus
GO:0006975 P DNA damage induced protein phosphorylation
GO:0007004 P telomere maintenance via telomerase
GO:0007049 P cell cycle
GO:0007050 P regulation of cell cycle
GO:0007094 P mitotic spindle assembly checkpoint signaling
GO:0007292 P female gamete generation
GO:0007420 P brain development
GO:0007507 P heart development
GO:0008340 P determination of adult lifespan
GO:0008630 P intrinsic apoptotic signaling pathway in response to DNA damage
GO:0010212 P response to ionizing radiation
GO:0010506 P regulation of autophagy
GO:0016023 C cytoplasmic vesicle
GO:0016301 F kinase activity
GO:0016303 F 1-phosphatidylinositol-3-kinase activity
GO:0016310 P phosphorylation
GO:0016572 P histone phosphorylation
GO:0016740 F transferase activity
GO:0016773 F phosphotransferase activity, alcohol group as acceptor
GO:0018105 P peptidyl-serine phosphorylation
GO:0030889 P negative regulation of B cell proliferation
GO:0031410 C cytoplasmic vesicle
GO:0032212 P positive regulation of telomere maintenance via telomerase
GO:0032403 F protein-containing complex binding
GO:0033129 P positive regulation of histone phosphorylation
GO:0033151 P V(D)J recombination
GO:0036092 P phosphatidylinositol-3-phosphate biosynthetic process
GO:0036289 P peptidyl-serine autophosphorylation
GO:0042159 P lipoprotein catabolic process
GO:0043065 P positive regulation of apoptotic process
GO:0043517 P positive regulation of DNA damage response, signal transduction by p53 class mediator
GO:0043525 P positive regulation of neuron apoptotic process
GO:0045141 P meiotic telomere clustering
GO:0046777 P protein autophosphorylation
GO:0046983 F protein dimerization activity
GO:0047485 F protein N-terminus binding
GO:0048599 P oocyte development
GO:0051402 P neuron apoptotic process
GO:0051726 P regulation of cell cycle
GO:0071044 P histone mRNA catabolic process
GO:0071480 P cellular response to gamma radiation
GO:0071500 P cellular response to nitrosative stress
GO:0072434 P mitotic G2 DNA damage checkpoint signaling
GO:0090399 P replicative senescence
GO:0097694 P establishment of RNA localization to telomere
GO:1901216 P positive regulation of neuron death
GO:1904262 P negative regulation of TORC1 signaling
GO:1904354 P negative regulation of telomere capping
GO:1904358 P positive regulation of telomere maintenance via telomere lengthening
GO:1904884 P positive regulation of telomerase catalytic core complex assembly
GO:1990391 C DNA repair complex
RNA-seq EntryA_TrvaFAMAMG_TR11762c0_g1_i1
Sequence
(Amino Acid)
MDLESTFRLVCDGLRFNRNSDRKKNAEALKEYLTRNAVPSMLTHNTHNKNGYSWSNLFDD
INEYILKEMEKFETSKTFETVTVPLCTSLLHLCVAGSNKGRAYVKCEKIMEACFIVLKDG
RLATAIGDAFLNLLYKYVLPLDHYLGFIKPSDWEDLLNISISNCLKPYSKLDDFTKLRFI
FIVTTKGSEYCQFVVSLKEALSQIKRCFLRLGQDQKLQSVIVDTSIVLVQMLSKECRLTT
CQFTENILSTILKFYDPNQDSLKKASLFELLNLIMMVHHPYGKTQSQDSSLASDWILWNK
HLQNIIEVIYLEINYIQKNPKHSMMKHSRHFSNLVAAIYFQIFKGLESEENDPGPSSKKQ
KTSFNKMKTFRDLLDQLRVNNLPWLEVVQVFTKKYGDQIGIDDYLILINIMDSIITSNKS
DVNWNIFEELACCILNIFIGQSACTKDYSISLILLWNSCVRNSSSNNFSHKTIHRIIQLL
LDLNVLTFQNVQGVVKLYTDKSMPVTDAAVTTLNSIIQRFFTKCISHESKISFFTWFISG
ENHCIDISKTQELISRLLTHENVNITREKVIADDCYFNLIFNNIDDCILYSEFEIDVHEK
LEPSVFNIDSFEIQADLMTHMNRTFISTITEYIENLKRKEIELLPYMEHLTIAIVFLERV
LKNKNNECQVDKDLCELLKTAMTHMFRRLQVVLASNTQIPVKIKLLVHLEKILSADFNSA
LNSLIRNCINDDFFHCINNILYIDAKNENDDIVCVEDDDLDVDALRHHCIYVLASFCKVC
GPCRDELLDLILDPKTYKYSTDVQCALRCIEILSDVAVQQPPSVLMFQLIANICKELYRN
PKASLGILKTIYNMMESIWSQNEIMKQNCCIMIKSYL
(291 a.a.)

- SilkBase 1999-2023 -