SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaFAMAMG14537_3prime_partial:A_TrvaFAMAMG_TR11754c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
excision_repair_cross-complementing_1_ercc1_[Danaus_plexippus]
Ontology
GO:0000014 F single-stranded DNA endodeoxyribonuclease activity
GO:0000109 C nucleotide-excision repair complex
GO:0000110 C nucleotide-excision repair factor 1 complex
GO:0000720 P pyrimidine dimer repair by nucleotide-excision repair
GO:0000784 C chromosome, telomeric region
GO:0001094 F TFIID-class transcription factor complex binding
GO:0001302 P obsolete replicative cell aging
GO:0003677 F DNA binding
GO:0003684 F damaged DNA binding
GO:0003697 F single-stranded DNA binding
GO:0004518 F nuclease activity
GO:0004519 F endonuclease activity
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005669 C transcription factor TFIID complex
GO:0005737 C cytoplasm
GO:0006281 P DNA repair
GO:0006289 P nucleotide-excision repair
GO:0006295 P nucleotide-excision repair, DNA incision, 3'-to lesion
GO:0006296 P nucleotide-excision repair, DNA incision, 5'-to lesion
GO:0006302 P double-strand break repair
GO:0006310 P DNA recombination
GO:0006312 P mitotic recombination
GO:0006949 P syncytium formation
GO:0006974 P cellular response to DNA damage stimulus
GO:0006979 P response to oxidative stress
GO:0007281 P germ cell development
GO:0007283 P spermatogenesis
GO:0008022 F protein C-terminus binding
GO:0008283 P cell population proliferation
GO:0008584 P male gonad development
GO:0009650 P UV protection
GO:0010165 P response to X-ray
GO:0010259 P multicellular organism aging
GO:0016787 F hydrolase activity
GO:0019904 F protein domain specific binding
GO:0032205 P negative regulation of telomere maintenance
GO:0035166 P post-embryonic hemopoiesis
GO:0035264 P multicellular organism growth
GO:0036297 P interstrand cross-link repair
GO:0043566 F DNA binding
GO:0045190 P isotype switching
GO:0048468 P cell development
GO:0048477 P oogenesis
GO:0051276 P chromosome organization
GO:0070522 C ERCC4-ERCC1 complex
GO:0090656 P t-circle formation
GO:1904431 P positive regulation of t-circle formation
RNA-seq EntryA_TrvaFAMAMG_TR11754c0_g1_i1
Sequence
(Amino Acid)
MEIEDGFDDLLAEIEDPVTPNKLKLDENAQPGTSNEPSSKPKSAKTHCVLVNKNQRGNPL
LKHITSVPWEYDDIIPDYEVGKTICLLFLSLRFHNLNPDYINNRLKELGKKYDLRVLLVQ
VDLKDPHASLKNLTRICLLTDITLMLAWNPEEAAKIVENYKIYENKPPDRIME
(56 a.a.)

- SilkBase 1999-2023 -