SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaFAMAMG14531_complete:A_TrvaFAMAMG_TR11753c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_kinesin-like_protein_KIF16B_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0001704 P formation of primary germ layer
GO:0001919 P regulation of receptor recycling
GO:0003777 F microtubule motor activity
GO:0005524 F ATP binding
GO:0005547 F phosphatidylinositol-3,4,5-trisphosphate binding
GO:0005737 C cytoplasm
GO:0005768 C endosome
GO:0005769 C early endosome
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005871 C kinesin complex
GO:0005874 C microtubule
GO:0006810 P transport
GO:0006895 P Golgi to endosome transport
GO:0007018 P microtubule-based movement
GO:0007173 P epidermal growth factor receptor signaling pathway
GO:0007492 P endoderm development
GO:0008017 F microtubule binding
GO:0008289 F lipid binding
GO:0008543 P fibroblast growth factor receptor signaling pathway
GO:0008574 F plus-end-directed microtubule motor activity
GO:0016020 C membrane
GO:0017137 F small GTPase binding
GO:0030705 P cytoskeleton-dependent intracellular transport
GO:0031901 C early endosome membrane
GO:0032266 F phosphatidylinositol-3-phosphate binding
GO:0032801 P receptor catabolic process
GO:0035091 F phosphatidylinositol binding
GO:0043325 F phosphatidylinositol-3,4-bisphosphate binding
GO:0045022 P early endosome to late endosome transport
GO:0080025 F phosphatidylinositol-3,5-bisphosphate binding
RNA-seq EntryA_TrvaFAMAMG_TR11753c0_g1_i1
Sequence
(Amino Acid)
MGDARRGRAHTPRVRGARVAGGALSVLAAVCCDQCDVVCATDAVVSVPGWVTRGAGARTH
HEYEVRVWLGARCRYSLLRRYRRFRDLYLEMKARYPAQVGCIPFPGRTLWAGEGVARSRR
GALEQFLRRLLRVAASDPRSPLHAAPLTRDKLVAFSPFFRKGVFESGKCGTG
*(56 a.a.)

- SilkBase 1999-2023 -