SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG14458_3prime_partial:A_TrvaFAMAMG_TR11733c0_g2_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_metabotropic_glutamate_receptor_5-like_[Bombyx_mori]
Ontology
GO:0004871 F obsolete signal transducer activity
GO:0004930 F G protein-coupled receptor activity
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0007165 P signal transduction
GO:0007186 P G protein-coupled receptor signaling pathway
GO:0007205 P protein kinase C-activating G protein-coupled receptor signaling pathway
GO:0007206 P phospholipase C-activating G protein-coupled glutamate receptor signaling pathway
GO:0007216 P G protein-coupled glutamate receptor signaling pathway
GO:0007268 P chemical synaptic transmission
GO:0007612 P learning
GO:0007626 P locomotory behavior
GO:0008066 F glutamate receptor activity
GO:0014069 C postsynaptic density
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0043005 C neuron projection
GO:0048169 P regulation of long-term neuronal synaptic plasticity
GO:0050890 P cognition
GO:0051966 P regulation of synaptic transmission, glutamatergic
GO:0070062 C extracellular exosome
RNA-seq EntryA_TrvaFAMAMG_TR11733c0_g2_i1
Sequence
(Amino Acid)
MCVCVQESAEESVPEGVLVGVLGPGASAAALHVQNLLQLFAVPQVSYSATSRELSDRARF
ATFYRVAPSDQHQARLLVALLQAHNWSYVHALHTDESYGQSGMAAFREEAARRGVCVARE
AALRGA
(41 a.a.)

- SilkBase 1999-2023 -