SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG14315_3prime_partial:A_TrvaFAMAMG_TR11462c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_lysine-specific_demethylase_phf2-like_isoform_X1_[Bombyx_mori]
Ontology
GO:0000082 P G1/S transition of mitotic cell cycle
GO:0003682 F chromatin binding
GO:0005506 F iron ion binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005730 C nucleolus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007049 P cell cycle
GO:0007420 P brain development
GO:0008270 F zinc ion binding
GO:0016491 F oxidoreductase activity
GO:0016568 P chromatin organization
GO:0016706 F 2-oxoglutarate-dependent dioxygenase activity
GO:0031965 C nuclear membrane
GO:0032452 F histone demethylase activity
GO:0032454 F histone H3-methyl-lysine-9 demethylase activity
GO:0033169 P histone H3-K9 demethylation
GO:0035064 F methylated histone binding
GO:0035574 P histone H4-K20 demethylation
GO:0035575 F histone H4-methyl-lysine-20 demethylase activity
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045943 P positive regulation of transcription by RNA polymerase I
GO:0046872 F metal ion binding
GO:0051213 F dioxygenase activity
GO:0051864 F histone H3-methyl-lysine-36 demethylase activity
GO:0055114 P obsolete oxidation-reduction process
GO:0061188 P negative regulation of ribosomal DNA heterochromatin assembly
GO:0070544 P histone H3-K36 demethylation
GO:0071557 P histone H3-K27 demethylation
GO:0071558 F histone H3-tri/di-methyl-lysine-27 demethylase activity
RNA-seq EntryA_TrvaFAMAMG_TR11462c0_g1_i1
Sequence
(Amino Acid)
MIECDCCREWFHGSCVDVKIYQSDDIDKYHCPKCAPTYGSSVLKIPTNNHRADRYEIGAE
SRPSQVGTPAWVRALAARAPRPSAQALQQMRAEQFTEEFVRDNGFTKPVIFHSPDGLDMK
MPNPSTFTVRSVLRFCGAQLEVEVIDVRKQATQRMTLADFVEYFETPPEHRDEKVLNVLS
LEFSETKLSGLVNPPHVITRLDWSVRAVPPHEVLRPAVQKYCLVSAAGSYTDFHVDFGGT
TVWYHVLHGRKTFYLIPPTSTNLALYQQWCSSNNHNERFFGDMVEWYGTTELTSGQTLFI
(99 a.a.)

- SilkBase 1999-2023 -