SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaFAMAMG1340_5prime_partial:A_TrvaFAMAMG_TR2255c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_transcription_factor_GATA-5-like_isoform_X4_[Papilio_xuthus]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000977 F RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000981 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000983 F RNA polymerase II general transcription initiation factor activity
GO:0001085 F RNA polymerase II-specific DNA-binding transcription factor binding
GO:0001103 F RNA polymerase II-specific DNA-binding transcription factor binding
GO:0001228 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0002805 P regulation of antimicrobial peptide biosynthetic process
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005667 C transcription regulator complex
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0007179 P transforming growth factor beta receptor signaling pathway
GO:0007350 P blastoderm segmentation
GO:0007389 P pattern specification process
GO:0007391 P dorsal closure
GO:0007398 P ectoderm development
GO:0007498 P mesoderm development
GO:0007507 P heart development
GO:0007510 P cardioblast cell fate determination
GO:0008270 F zinc ion binding
GO:0008407 P chaeta morphogenesis
GO:0010002 P cardioblast differentiation
GO:0010906 P regulation of glucose metabolic process
GO:0022416 P chaeta development
GO:0030154 P cell differentiation
GO:0035050 P embryonic heart tube development
GO:0035051 P cardiocyte differentiation
GO:0042440 P pigment metabolic process
GO:0043565 F sequence-specific DNA binding
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0046982 F protein heterodimerization activity
GO:0048468 P cell development
GO:0048542 P lymph gland development
GO:0048565 P digestive tract development
GO:0048646 P anatomical structure formation involved in morphogenesis
GO:0060047 P heart contraction
GO:0061320 P pericardial nephrocyte differentiation
RNA-seq EntryA_TrvaFAMAMG_TR2255c0_g1_i1
Sequence
(Amino Acid)
TGHYLCNACGLYHKINGVNRPLVKPSKRLSAARRHGQCCTNCGSRNTTLWRRNNDGEPVC
NACGLYFKLHNVNRPLSMKKDGIQTRKRKPKSMGGGHGGVARPPGGGSLSGYQR
*(37 a.a.)

- SilkBase 1999-2023 -