| Name | O_TrvaFAMAMG13319_complete:A_TrvaFAMAMG_TR11322c1_g1_i2 |
| Scaffold_id | |
NCBI non-redundant
(nr) | PREDICTED:_uncharacterized_protein_LOC105841959_[Bombyx_mori] |
| Ontology |
| GO:0004222 |
F |
metalloendopeptidase activity |
| GO:0005737 |
C |
cytoplasm |
| GO:0005886 |
C |
plasma membrane |
| GO:0006508 |
P |
proteolysis |
| GO:0007155 |
P |
cell adhesion |
| GO:0007338 |
P |
single fertilization |
| GO:0008233 |
F |
peptidase activity |
| GO:0008237 |
F |
metallopeptidase activity |
| GO:0008270 |
F |
zinc ion binding |
| GO:0009566 |
P |
fertilization |
| GO:0010954 |
P |
positive regulation of protein processing |
| GO:0016020 |
C |
membrane |
| GO:0016787 |
F |
hydrolase activity |
| GO:0030133 |
C |
transport vesicle |
| GO:0031410 |
C |
cytoplasmic vesicle |
| GO:0046872 |
F |
metal ion binding |
| GO:0060468 |
P |
prevention of polyspermy |
| GO:0060473 |
C |
cortical granule |
| GO:0070001 |
F |
aspartic-type peptidase activity |
| GO:0070002 |
F |
glutamic-type peptidase activity |
| GO:2000360 |
P |
negative regulation of binding of sperm to zona pellucida |
|
| RNA-seq Entry | A_TrvaFAMAMG_TR11322c1_g1_i2 |
Sequence
(Amino Acid) | MMVMKALGFPFEHNRPNRDLYIQVLMENVQPGKYLVLFKFNNNNNLYLKATNGPKNVSIT
NNLQAMLVIKMKVFVNRYCTAPCETAQQRFTYTQSSLVAIIFRTLLEPARTLRTRDAHLL
RIVA
*(40 a.a.) |
