SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG1291_internal:A_TrvaFAMAMG_TR2140c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_protein_dachsous-like_[Amyelois_transitella]
Ontology
GO:0000904 P cell morphogenesis involved in differentiation
GO:0001736 P establishment of planar polarity
GO:0001737 P establishment of imaginal disc-derived wing hair orientation
GO:0004871 F obsolete signal transducer activity
GO:0004872 F signaling receptor activity
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0007155 P cell adhesion
GO:0007156 P homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007157 P heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules
GO:0007164 P establishment of tissue polarity
GO:0007165 P signal transduction
GO:0007275 P multicellular organism development
GO:0007476 P imaginal disc-derived wing morphogenesis
GO:0007480 P imaginal disc-derived leg morphogenesis
GO:0008283 P cell population proliferation
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016318 P ommatidial rotation
GO:0016337 P cell-cell adhesion
GO:0016339 P calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules
GO:0018149 P peptide cross-linking
GO:0030010 P establishment of cell polarity
GO:0035159 P regulation of tube length, open tracheal system
GO:0035222 P wing disc pattern formation
GO:0042067 P establishment of ommatidial planar polarity
GO:0044331 P cell-cell adhesion mediated by cadherin
GO:0045198 P establishment of epithelial cell apical/basal polarity
GO:0045296 F cadherin binding
GO:0045317 P equator specification
GO:0048592 P eye morphogenesis
GO:0050839 F cell adhesion molecule binding
GO:0090175 P regulation of establishment of planar polarity
GO:0090176 P microtubule cytoskeleton organization involved in establishment of planar polarity
RNA-seq EntryA_TrvaFAMAMG_TR2140c0_g1_i1
Sequence
(Amino Acid)
RLSTSVTVHISITDANDNAPIFVSATNAIVSINTLSDVIYQALAIDSDYGENGRISYYIS
SGNEHSYFSLDYDSGRLTVSNKYASDVNKIRPGLFKLNLTASDHGMPFPRTSHMTLQLSL
QESTNIPPRYTEL
(43 a.a.)

- SilkBase 1999-2023 -