SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaFAMAMG12894_complete:A_TrvaFAMAMG_TR11285c2_g3_i4
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_agrin-like_[Bombyx_mori]
Ontology
GO:0001934 P positive regulation of protein phosphorylation
GO:0002162 F dystroglycan binding
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005576 C extracellular region
GO:0005604 C basement membrane
GO:0005605 C basement membrane
GO:0005615 C extracellular space
GO:0005737 C cytoplasm
GO:0005796 C Golgi lumen
GO:0005886 C plasma membrane
GO:0006024 P glycosaminoglycan biosynthetic process
GO:0007009 P plasma membrane organization
GO:0007268 P chemical synaptic transmission
GO:0007275 P multicellular organism development
GO:0007528 P neuromuscular junction development
GO:0008582 P regulation of synaptic assembly at neuromuscular junction
GO:0009986 C cell surface
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0030054 C cell junction
GO:0030154 P cell differentiation
GO:0030548 F acetylcholine receptor regulator activity
GO:0031012 C extracellular matrix
GO:0032092 P positive regulation of protein binding
GO:0033691 F sialic acid binding
GO:0035374 F chondroitin sulfate binding
GO:0042030 F ATPase inhibitor activity
GO:0042383 C sarcolemma
GO:0043087 P regulation of GTPase activity
GO:0043113 P receptor clustering
GO:0043395 F heparan sulfate proteoglycan binding
GO:0043525 P positive regulation of neuron apoptotic process
GO:0043547 P positive regulation of GTPase activity
GO:0044325 F transmembrane transporter binding
GO:0045202 C synapse
GO:0045213 P neurotransmitter receptor metabolic process
GO:0045887 P positive regulation of synaptic assembly at neuromuscular junction
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0051491 P positive regulation of filopodium assembly
GO:0055117 P regulation of cardiac muscle contraction
GO:0061098 P positive regulation of protein tyrosine kinase activity
GO:0070062 C extracellular exosome
GO:0086036 P regulation of cardiac muscle cell membrane potential
GO:0099601 P regulation of neurotransmitter receptor activity
GO:1903277 P negative regulation of sodium ion export across plasma membrane
GO:1903407 P negative regulation of P-type sodium:potassium-exchanging transporter activity
GO:2000541 P positive regulation of protein geranylgeranylation
RNA-seq EntryA_TrvaFAMAMG_TR11285c2_g3_i4
Sequence
(Amino Acid)
MWRRKIGIRPRDFIGLGLSNGKLQLIYTDTDSKDMNSATHEDWFQSLESKLRVDDGRWHT
AMIRRRKRLAMLHVDDLPPVRGYSQSLLVPSKSNPKLWIGGSPTLPLGLPSALYTGLRGC
VASVKANGRHIDLNSPIRPTTTIRHCN
*(48 a.a.)

- SilkBase 1999-2023 -