SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaFAMAMG12866_5prime_partial:A_TrvaFAMAMG_TR11283c4_g2_i13
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_serine/arginine_repetitive_matrix_protein_1-like_[Bombyx_mori]
Ontology
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0003723 F RNA binding
GO:0003824 F catalytic activity
GO:0003887 F DNA-directed DNA polymerase activity
GO:0003964 F RNA-directed DNA polymerase activity
GO:0004190 F aspartic-type endopeptidase activity
GO:0004518 F nuclease activity
GO:0004519 F endonuclease activity
GO:0004523 F RNA-DNA hybrid ribonuclease activity
GO:0004533 F exoribonuclease H activity
GO:0005198 F structural molecule activity
GO:0005622 C intracellular anatomical structure
GO:0006278 P RNA-dependent DNA biosynthetic process
GO:0006310 P DNA recombination
GO:0006508 P proteolysis
GO:0008152 P metabolic process
GO:0008233 F peptidase activity
GO:0008270 F zinc ion binding
GO:0008289 F lipid binding
GO:0015074 P DNA integration
GO:0016020 C membrane
GO:0016032 P viral process
GO:0016740 F transferase activity
GO:0016779 F nucleotidyltransferase activity
GO:0016787 F hydrolase activity
GO:0019012 C virion component
GO:0019013 C viral nucleocapsid
GO:0019028 C viral capsid
GO:0019076 P viral release from host cell
GO:0020002 C host cell plasma membrane
GO:0030430 C host cell cytoplasm
GO:0033644 C host cell membrane
GO:0039657 P suppression by virus of host gene expression
GO:0042025 C host cell nucleus
GO:0044174 C host cell endosome
GO:0046718 P viral entry into host cell
GO:0046872 F metal ion binding
GO:0055036 C virion membrane
GO:0071897 P DNA biosynthetic process
GO:0072494 C host multivesicular body
GO:0075713 P establishment of integrated proviral latency
GO:0075732 P viral penetration into host nucleus
GO:0090305 P nucleic acid phosphodiester bond hydrolysis
GO:0090502 P RNA phosphodiester bond hydrolysis, endonucleolytic
GO:0090503 P RNA phosphodiester bond hydrolysis, exonucleolytic
RNA-seq EntryA_TrvaFAMAMG_TR11283c4_g2_i13
Sequence
(Amino Acid)
EVRVHRPVKMAELRVTGLDDCTSREEVVAAIAAQGKCAPENVAVGELRRGYTGASSVWVR
CPVETANSLATPPPGRPAGDPGRLRVGWVAAHVRLLESRAWRCLKCFGTGHSVARCTSTV
DRSGLCFRCGQAGHKATVCSAAPHCALCAAAGRKADHRAGGKACSPSGANTERNRRRKSK
RRQQKRSAGGVPAGISDPAVAPSAPEGGGDRGGEGAMEVVQP
*(73 a.a.)

- SilkBase 1999-2023 -