SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaFAMAMG12674_internal:A_TrvaFAMAMG_TR11088c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
microtubule-associated_protein_futsch_[Danaus_plexippus]
Ontology
GO:0000226 P microtubule cytoskeleton organization
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005856 C cytoskeleton
GO:0005874 C microtubule
GO:0005875 C microtubule associated complex
GO:0007017 P microtubule-based process
GO:0007275 P multicellular organism development
GO:0007399 P nervous system development
GO:0007409 P axonogenesis
GO:0007528 P neuromuscular junction development
GO:0008017 F microtubule binding
GO:0008088 P axo-dendritic transport
GO:0008355 P olfactory learning
GO:0008582 P regulation of synaptic assembly at neuromuscular junction
GO:0015630 C microtubule cytoskeleton
GO:0019900 F kinase binding
GO:0030424 C axon
GO:0030425 C dendrite
GO:0043025 C neuronal cell body
GO:0043524 P negative regulation of neuron apoptotic process
GO:0048749 P compound eye development
GO:0048813 P dendrite morphogenesis
GO:0060052 P neurofilament cytoskeleton organization
GO:1901215 P negative regulation of neuron death
RNA-seq EntryA_TrvaFAMAMG_TR11088c0_g1_i1
Sequence
(Amino Acid)
EREIVREIEAVFNRDSEAEEKVEFIGRSDIEKITCLLDEAKTETTADGEFEEEYLIIEKE
ELEHYPQEPTVDHDAKLEQGDELQKHLKDKEESEKKKDTQTE
(33 a.a.)

- SilkBase 1999-2023 -