SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaFAMAMG12572_internal:A_TrvaFAMAMG_TR10828c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_organic_cation_transporter_protein-like_[Bombyx_mori]
Ontology
GO:0005215 F transporter activity
GO:0005277 F acetylcholine transmembrane transporter activity
GO:0005329 F dopamine:sodium symporter activity
GO:0005333 F norepinephrine:sodium symporter activity
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006812 P cation transport
GO:0006836 P neurotransmitter transport
GO:0006855 P xenobiotic transmembrane transport
GO:0008504 F monoamine transmembrane transporter activity
GO:0008513 F secondary active organic cation transmembrane transporter activity
GO:0010248 P establishment or maintenance of transmembrane electrochemical gradient
GO:0015101 F organic cation transmembrane transporter activity
GO:0015651 F quaternary ammonium group transmembrane transporter activity
GO:0015695 P organic cation transport
GO:0015697 P quaternary ammonium group transport
GO:0015844 P monoamine transport
GO:0015872 P dopamine transport
GO:0015874 P norepinephrine transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016323 C basolateral plasma membrane
GO:0022857 F transmembrane transporter activity
GO:0042802 F identical protein binding
GO:0042803 F protein homodimerization activity
GO:0048241 P epinephrine transport
GO:0051260 P protein homooligomerization
GO:0055085 P transmembrane transport
GO:0072488 P ammonium transmembrane transport
GO:1901374 P acetate ester transport
RNA-seq EntryA_TrvaFAMAMG_TR10828c0_g1_i1
Sequence
(Amino Acid)
LLINLLLINFSSFRFGRKPALITSVVVEIITGIMSSFMPDFWSFTIFRMMLGVSVGGIMV
VGFVIVMEFVGNDVRDIISALYHVPFTVGHMLLALLGYFIRDYVYFELAISAVNIFLLIY
ICILPESPRWLLAVNKSFEAITLIESIAKTNDLNVEDISAKIELFQLEHRPRKSSFLELF
KYPNLR
(61 a.a.)

- SilkBase 1999-2023 -