SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG12529_complete:A_TrvaFAMAMG_TR10791c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_ras-related_protein_Rab6_isoform_X1_[Papilio_polytes]
Ontology
GO:0000139 C Golgi membrane
GO:0000166 F nucleotide binding
GO:0001745 P compound eye morphogenesis
GO:0003779 F actin binding
GO:0003924 F GTPase activity
GO:0005515 F protein binding
GO:0005525 F GTP binding
GO:0005622 C intracellular anatomical structure
GO:0005794 C Golgi apparatus
GO:0005829 C cytosol
GO:0006810 P transport
GO:0006886 P intracellular protein transport
GO:0006887 P exocytosis
GO:0006890 P retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum
GO:0006891 P intra-Golgi vesicle-mediated transport
GO:0006913 P nucleocytoplasmic transport
GO:0007165 P signal transduction
GO:0007264 P small GTPase mediated signal transduction
GO:0007293 P germarium-derived egg chamber formation
GO:0007411 P axon guidance
GO:0008103 P oocyte microtubule cytoskeleton polarization
GO:0008152 P metabolic process
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016023 C cytoplasmic vesicle
GO:0016192 P vesicle-mediated transport
GO:0030054 C cell junction
GO:0031982 C vesicle
GO:0032482 P Rab protein signal transduction
GO:0042147 P retrograde transport, endosome to Golgi
GO:0043025 C neuronal cell body
GO:0043204 C perikaryon
GO:0045202 C synapse
GO:0045451 P pole plasm oskar mRNA localization
GO:0045467 P R7 cell development
GO:0050832 P defense response to fungus
GO:0060078 P regulation of postsynaptic membrane potential
RNA-seq EntryA_TrvaFAMAMG_TR10791c0_g1_i1
Sequence
(Amino Acid)
MSTSGEFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDR
TVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNANSFHQTSKWIDDVRTERGSDVI
IMLVGNKTDLSDKRQVSTEEGDKKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMDSA
ENKPPEDTVDLQTQSPMCSVQEGNESGCVC
*(69 a.a.)

- SilkBase 1999-2023 -