SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaFAMAMG12210_complete:A_TrvaFAMAMG_TR10741c1_g1_i3
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_potassium_voltage-gated_channel_protein_Shaker_isoform_X8_[Bombyx_mori]
Ontology
GO:0001508 P action potential
GO:0005216 F ion channel activity
GO:0005244 F voltage-gated ion channel activity
GO:0005249 F voltage-gated potassium channel activity
GO:0005251 F delayed rectifier potassium channel activity
GO:0005267 F potassium channel activity
GO:0005886 C plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006813 P potassium ion transport
GO:0007611 P learning or memory
GO:0007619 P courtship behavior
GO:0007629 P flight behavior
GO:0007637 P proboscis extension reflex
GO:0008076 C voltage-gated potassium channel complex
GO:0008345 P larval locomotory behavior
GO:0009584 P detection of visible light
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0022843 F voltage-gated cation channel activity
GO:0030431 P sleep
GO:0034765 P regulation of ion transmembrane transport
GO:0045187 P regulation of circadian sleep/wake cycle, sleep
GO:0048047 P mating behavior, sex discrimination
GO:0048150 P behavioral response to ether
GO:0048675 P axon extension
GO:0050909 P sensory perception of taste
GO:0051260 P protein homooligomerization
GO:0055085 P transmembrane transport
GO:0060025 P regulation of synaptic activity
GO:0071805 P potassium ion transmembrane transport
RNA-seq EntryA_TrvaFAMAMG_TR10741c1_g1_i3
Sequence
(Amino Acid)
MNIIDIIAIIPYFITLATVVAEEEDTLNLPRAPVSPQDKSTNQAMSLAILRVIRLVRVFR
IFKLSRHSKGLQILGRTLKASMRELGLLIFFLFIGVVLFSSAVYFAEAGSENSFFKSIPD
AFWWAVVTMTTVGYGDMTPVGVWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDQ
EEMQSQNFNHVTSCPYLPGTMGEPYLSGKDDERDEVCCDH
*(72 a.a.)

- SilkBase 1999-2023 -