SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaFAMAMG12109_complete:A_TrvaFAMAMG_TR10738c0_g1_i6
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_LOW_QUALITY_PROTEIN:_protein_diaphanous_[Bombyx_mori]
Ontology
GO:0000281 P mitotic cytokinesis
GO:0000915 P actomyosin contractile ring assembly
GO:0003383 P apical constriction
GO:0003779 F actin binding
GO:0005515 F protein binding
GO:0005546 F phosphatidylinositol-4,5-bisphosphate binding
GO:0005737 C cytoplasm
GO:0005856 C cytoskeleton
GO:0005884 C actin filament
GO:0005912 C adherens junction
GO:0005938 C cell cortex
GO:0007015 P actin filament organization
GO:0007049 P cell cycle
GO:0007110 P meiosis I cytokinesis
GO:0007111 P meiosis II cytokinesis
GO:0007279 P pole cell formation
GO:0007283 P spermatogenesis
GO:0007349 P cellularization
GO:0007424 P open tracheal system development
GO:0007605 P sensory perception of sound
GO:0008104 P protein localization
GO:0009306 P protein secretion
GO:0012506 C vesicle membrane
GO:0016043 P cellular component organization
GO:0016324 C apical plasma membrane
GO:0016476 P regulation of embryonic cell shape
GO:0017048 F small GTPase binding
GO:0022008 P neurogenesis
GO:0030036 P actin cytoskeleton organization
GO:0030589 P pseudocleavage involved in syncytial blastoderm formation
GO:0030838 P positive regulation of actin filament polymerization
GO:0031532 P actin cytoskeleton reorganization
GO:0032154 C cleavage furrow
GO:0032507 P maintenance of protein location in cell
GO:0035011 P melanotic encapsulation of foreign target
GO:0035230 C cytoneme
GO:0043234 C protein-containing complex
GO:0045010 P actin nucleation
GO:0045177 C apical part of cell
GO:0045448 P mitotic cell cycle, embryonic
GO:0051225 P spindle assembly
GO:0051301 P cell division
GO:0051489 P regulation of filopodium assembly
GO:0090303 P positive regulation of wound healing
GO:0097320 P plasma membrane tubulation
RNA-seq EntryA_TrvaFAMAMG_TR10738c0_g1_i6
Sequence
(Amino Acid)
MENDIKALEMDLNNSKVQQCPDDLFFETMSEFAKEAREQCDLLHSMFRKMESLYKELAEY
YVFDPQKYTLEEFFSDVKTFKDSFMTAHQENVVSRETEERARRAKEARAAAEQERRDRQH
RYKQFVDMERAQDGVMDSLMEALQSGSAFSRERPRKKANPRVAGAERRAQLSRSRSRSGL
TGAMTTRELTNELLSNA
*(65 a.a.)

- SilkBase 1999-2023 -