| Name | O_TrvaFAMAMG11823_complete:A_TrvaFAMAMG_TR10706c3_g8_i1 |
| Scaffold_id | |
NCBI non-redundant (nr) | PREDICTED:_nucleoporin_Nup43_[Amyelois_transitella] |
| Ontology |
| GO:0000775 |
C |
chromosome, centromeric region |
| GO:0000776 |
C |
kinetochore |
| GO:0000777 |
C |
kinetochore |
| GO:0005515 |
F |
protein binding |
| GO:0005634 |
C |
nucleus |
| GO:0005635 |
C |
nuclear envelope |
| GO:0005643 |
C |
nuclear pore |
| GO:0005694 |
C |
chromosome |
| GO:0005829 |
C |
cytosol |
| GO:0006406 |
P |
mRNA export from nucleus |
| GO:0006409 |
P |
tRNA export from nucleus |
| GO:0006810 |
P |
transport |
| GO:0007049 |
P |
cell cycle |
| GO:0007059 |
P |
chromosome segregation |
| GO:0007062 |
P |
sister chromatid cohesion |
| GO:0007067 |
P |
mitotic cell cycle |
| GO:0007077 |
P |
mitotic nuclear membrane disassembly |
| GO:0010827 |
P |
regulation of glucose transmembrane transport |
| GO:0015031 |
P |
protein transport |
| GO:0016032 |
P |
viral process |
| GO:0016925 |
P |
protein sumoylation |
| GO:0019083 |
P |
viral transcription |
| GO:0031047 |
P |
gene silencing by RNA |
| GO:0031080 |
C |
nuclear pore outer ring |
| GO:0051028 |
P |
mRNA transport |
| GO:0051301 |
P |
cell division |
| GO:0075733 |
P |
intracellular transport of virus |
| GO:1900034 |
P |
regulation of cellular response to heat |
|
| RNA-seq Entry | A_TrvaFAMAMG_TR10706c3_g8_i1 |
Sequence (Amino Acid) | MTGNIRGHMKIWDLRLEADKPAASFLLAGDELAATCIVKHPTQPHIVLAGSESGSLAVWD
LRMNTFPTSLVTAHSAGVTEMQFHPENPQKLLTCSVSGEIWDWNMEEMTKSARGPDSEIM
FMPLQDKNAMVVNPLMPTLHKAVNTLHCDKGRILCGADNEAVYLIKNFKY
*(56 a.a.) |