Name | O_TrvaFAMAMG11817_complete:A_TrvaFAMAMG_TR10706c3_g3_i1 |
Scaffold_id | |
NCBI non-redundant (nr) | putative_nucleoporin_Nup43_[Danaus_plexippus] |
Ontology |
GO:0000775 |
C |
chromosome, centromeric region |
GO:0000776 |
C |
kinetochore |
GO:0000777 |
C |
kinetochore |
GO:0005515 |
F |
protein binding |
GO:0005634 |
C |
nucleus |
GO:0005635 |
C |
nuclear envelope |
GO:0005643 |
C |
nuclear pore |
GO:0005694 |
C |
chromosome |
GO:0005829 |
C |
cytosol |
GO:0006406 |
P |
mRNA export from nucleus |
GO:0006409 |
P |
tRNA export from nucleus |
GO:0006810 |
P |
transport |
GO:0007049 |
P |
cell cycle |
GO:0007059 |
P |
chromosome segregation |
GO:0007062 |
P |
sister chromatid cohesion |
GO:0007067 |
P |
mitotic cell cycle |
GO:0007077 |
P |
mitotic nuclear membrane disassembly |
GO:0010827 |
P |
regulation of glucose transmembrane transport |
GO:0015031 |
P |
protein transport |
GO:0016032 |
P |
viral process |
GO:0016925 |
P |
protein sumoylation |
GO:0019083 |
P |
viral transcription |
GO:0031047 |
P |
gene silencing by RNA |
GO:0031080 |
C |
nuclear pore outer ring |
GO:0051028 |
P |
mRNA transport |
GO:0051301 |
P |
cell division |
GO:0075733 |
P |
intracellular transport of virus |
GO:1900034 |
P |
regulation of cellular response to heat |
|
RNA-seq Entry | A_TrvaFAMAMG_TR10706c3_g3_i1 |
Sequence (Amino Acid) | MPIDVQGTFVSQKINKIRWIPEEYAETKHFITGSWDDEVNSIKVWGFESVNPEEEVECPR
VLSEYPVDGDVTQIRFTEKNKIAVSVSNGDLNVFEISEYEKQTPLIEVFSWKGLHNYGND
KCSCTSLDTFEGDIASVGEDGNVNILSSRRGEKNGTIKEADSCSIHSVCYLKYTEVSFIL
TCI
*(60 a.a.) |