SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG11599_complete:A_TrvaFAMAMG_TR10695c3_g2_i2
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_ribonuclease_UK114-like_[Amyelois_transitella]
Ontology
GO:0001822 P kidney development
GO:0004518 F nuclease activity
GO:0004519 F endonuclease activity
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005777 C peroxisome
GO:0005829 C cytosol
GO:0006449 P regulation of translational termination
GO:0007420 P brain development
GO:0016787 F hydrolase activity
GO:0016892 F endoribonuclease activity, producing 3'-phosphomonoesters
GO:0017148 P negative regulation of translation
GO:0030324 P lung development
GO:0033993 P response to lipid
GO:0036041 F long-chain fatty acid binding
GO:0042803 F protein homodimerization activity
GO:0043167 F ion binding
GO:0044822 F RNA binding
GO:0046914 F transition metal ion binding
GO:0050680 P negative regulation of epithelial cell proliferation
GO:0070062 C extracellular exosome
GO:0070314 P G1 to G0 transition
GO:0090502 P RNA phosphodiester bond hydrolysis, endonucleolytic
GO:1902074 P response to salt
GO:1904012 F obsolete platinum binding
GO:1904013 F obsolete xenon atom binding
RNA-seq EntryA_TrvaFAMAMG_TR10695c3_g2_i2
Sequence
(Amino Acid)
MIYHLLFSQAILADKTLYVSGVLGLDKDAQMVCGGAEAQTRQALDNLRHVLEAGGASLES
VVKTTVLLANMDDFQAFNKVYAQYFPKACPARATYEVSRLPLGAAVEIEAVALCGDLVIA
EAGPCPCSR
*(42 a.a.)

- SilkBase 1999-2023 -