SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG11507_complete:A_TrvaFAMAMG_TR10684c0_g2_i2
Scaffold_id
NCBI non-redundant
(nr)		putative_potassium-dependent_sodium-calcium_exchanger_[Danaus_plexippus]
Ontology
GO:0005262 F calcium channel activity
GO:0005509 F calcium ion binding
GO:0005887 C integral component of plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006813 P potassium ion transport
GO:0006814 P sodium ion transport
GO:0006816 P calcium ion transport
GO:0006874 P cellular calcium ion homeostasis
GO:0008273 F calcium, potassium:sodium antiporter activity
GO:0015293 F symporter activity
GO:0015297 F antiporter activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0030955 F potassium ion binding
GO:0031402 F sodium ion binding
GO:0035725 P sodium ion transmembrane transport
GO:0055085 P transmembrane transport
GO:0070588 P calcium ion transmembrane transport
RNA-seq EntryA_TrvaFAMAMG_TR10684c0_g2_i2
Sequence
(Amino Acid)
MAVSNAVGSNVFDILVCLGLPWFIQTAIIQPGSHVNVYSKGLIYSTLSLFSTVVFLVVAT
HANGWKLDRKYGAVLMVWYILFITLASLYELNVFGEYNKPDCISKY
*(34 a.a.)

- SilkBase 1999-2023 -