SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaFAMAMG11486_5prime_partial:A_TrvaFAMAMG_TR10677c3_g1_i5
Scaffold_id
NCBI non-redundant
(nr)
Calcium-activated_potassium_channel_slowpoke_[Camponotus_floridanus]
Ontology
GO:0005216 F ion channel activity
GO:0005244 F voltage-gated ion channel activity
GO:0005249 F voltage-gated potassium channel activity
GO:0005267 F potassium channel activity
GO:0005515 F protein binding
GO:0005886 C plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006813 P potassium ion transport
GO:0007623 P circadian rhythm
GO:0008076 C voltage-gated potassium channel complex
GO:0008582 P regulation of synaptic assembly at neuromuscular junction
GO:0015269 F calcium-activated potassium channel activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0034765 P regulation of ion transmembrane transport
GO:0042493 P response to xenobiotic stimulus
GO:0043005 C neuron projection
GO:0043025 C neuronal cell body
GO:0045433 P male courtship behavior, veined wing generated song production
GO:0048512 P circadian behavior
GO:0055085 P transmembrane transport
GO:0060072 F large conductance calcium-activated potassium channel activity
GO:0071805 P potassium ion transmembrane transport
GO:1900074 P negative regulation of neuromuscular synaptic transmission
RNA-seq EntryA_TrvaFAMAMG_TR10677c3_g1_i5
Sequence
(Amino Acid)
VHEADACLVLANKYCQDPDAEDAANIMRVISIKNYSDDIRVIIQLMQYHNKAYLLNIPSW
DWKQGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRSFKTVSSYIFSLILSN
*(37 a.a.)

- SilkBase 1999-2023 -