SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG11463_5prime_partial:A_TrvaFAMAMG_TR10674c13_g3_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_potassium_voltage-gated_channel_protein_eag_[Bombyx_mori]
Ontology
GO:0000155 F phosphorelay sensor kinase activity
GO:0000160 P phosphorelay signal transduction system
GO:0005216 F ion channel activity
GO:0005244 F voltage-gated ion channel activity
GO:0005249 F voltage-gated potassium channel activity
GO:0005267 F potassium channel activity
GO:0005515 F protein binding
GO:0005622 C intracellular anatomical structure
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006813 P potassium ion transport
GO:0007275 P multicellular organism development
GO:0007399 P nervous system development
GO:0007608 P sensory perception of smell
GO:0007611 P learning or memory
GO:0007612 P learning
GO:0007619 P courtship behavior
GO:0007629 P flight behavior
GO:0008016 P regulation of heart contraction
GO:0008076 C voltage-gated potassium channel complex
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0022843 F voltage-gated cation channel activity
GO:0023014 P signal transduction
GO:0030154 P cell differentiation
GO:0034765 P regulation of ion transmembrane transport
GO:0042066 P perineurial glial growth
GO:0042391 P regulation of membrane potential
GO:0048150 P behavioral response to ether
GO:0051259 P protein complex oligomerization
GO:0055085 P transmembrane transport
GO:0071805 P potassium ion transmembrane transport
RNA-seq EntryA_TrvaFAMAMG_TR10674c13_g3_i1
Sequence
(Amino Acid)
APPAPPAPPPVSHDAALAELRRDVRNEVQRLQQKLGRVEELLTMLAARLGADPSDTATAA
EPETPRAPPTDLVAITRKRRSKGRSKGAAPQAPTPTSPTETPPSPSGTSGASSGASSGAA
SGATSGAGSGAGSGAAQRRREFV
*(47 a.a.)

- SilkBase 1999-2023 -