SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaFAMAMG11406_complete:A_TrvaFAMAMG_TR10669c3_g1_i3
Scaffold_id
NCBI non-redundant
(nr)
atypical_protein_kinase_C_[Bombyx_mori]
Ontology
GO:0000132 P establishment of mitotic spindle orientation
GO:0000166 F nucleotide binding
GO:0001738 P morphogenesis of a polarized epithelium
GO:0002052 P positive regulation of neuroblast proliferation
GO:0003382 P epithelial cell morphogenesis
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004697 F protein kinase C activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0005938 C cell cortex
GO:0006468 P protein phosphorylation
GO:0007043 P cell-cell junction assembly
GO:0007163 P establishment or maintenance of cell polarity
GO:0007283 P spermatogenesis
GO:0007294 P germarium-derived oocyte fate determination
GO:0007309 P oocyte axis specification
GO:0007314 P oocyte anterior/posterior axis specification
GO:0007416 P synapse assembly
GO:0007423 P sensory organ development
GO:0007430 P terminal branching, open tracheal system
GO:0007613 P memory
GO:0010592 P positive regulation of lamellipodium assembly
GO:0016020 C membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016324 C apical plasma membrane
GO:0016327 C apicolateral plasma membrane
GO:0016332 P establishment or maintenance of polarity of embryonic epithelium
GO:0016334 P establishment or maintenance of polarity of follicular epithelium
GO:0016740 F transferase activity
GO:0017022 F myosin binding
GO:0018105 P peptidyl-serine phosphorylation
GO:0030011 P maintenance of cell polarity
GO:0034332 P adherens junction organization
GO:0035003 C subapical complex
GO:0035011 P melanotic encapsulation of foreign target
GO:0035556 P intracellular signal transduction
GO:0045167 P asymmetric protein localization involved in cell fate determination
GO:0045176 P apical protein localization
GO:0045179 C apical cortex
GO:0045186 P zonula adherens assembly
GO:0045196 P establishment or maintenance of neuroblast polarity
GO:0045197 P establishment or maintenance of epithelial cell apical/basal polarity
GO:0045198 P establishment of epithelial cell apical/basal polarity
GO:0046667 P compound eye retinal cell programmed cell death
GO:0046872 F metal ion binding
GO:0051491 P positive regulation of filopodium assembly
GO:0051601 P exocyst localization
GO:0055059 P asymmetric neuroblast division
GO:0060446 P branching involved in open tracheal system development
GO:0072659 P protein localization to plasma membrane
GO:0090163 P establishment of epithelial cell planar polarity
RNA-seq EntryA_TrvaFAMAMG_TR10669c3_g1_i3
Sequence
(Amino Acid)
MMPTQLANQDNHVNDVRVKTVYNGDVMITYINHKISFEDFLVEMMAICRFPIDQVFTMKW
VDEEGDPCTISTQLELDEALRLYELNRDSELTVHVFPNVPAAPGMPCAGEDRSIYRRGAR
RWRKLYRVNGHIFQAKRFNRRAFCAFCQDRIWGLGRQGFKCIQCKLLVHKKCHKLVQKPC
SNEHVDPIEIKDDANGEATLGRVSSVRSRADEQPPLPETPPAPAPPARPEDLEPGSQRQY
SLDDFELIRVIGRGSYAKVLMVELKRTKRIYAMKVIKKALVTDDEDIDWVQTEKHVFETA
SNHPFLVGLHSCFQTPSRLFFVIEFVRGGDLMFHMQRQRRLPEEHARFYAAEISLALHFL
HERGVIYRDLKLDNVLLDHEGHIKLTDYGMCKEGVRPGDTTSTFCGTPNYIAPEILRGEE
YGFSVDWWALGVLTYEMLAGRSPFDIAQAADNPDQNTEDYLFQVILEKTIRIPRSLSVKA
ASVLKGFLNKNPVERLGCGDSGFLDIVNHPFFKSIDWEMLEQKQVVPPFKPRLEGERDLA
NFPPEFTDEPVHLTPDNESVIADIDQSEFEGFEYVNPLLMSLEDCV
*(194 a.a.)

- SilkBase 1999-2023 -