SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaFAMAMG11390_internal:A_TrvaFAMAMG_TR10669c2_g2_i1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_protein_kinase_C_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004697 F protein kinase C activity
GO:0004698 F calcium-dependent protein kinase C activity
GO:0005524 F ATP binding
GO:0005622 C intracellular anatomical structure
GO:0005886 C plasma membrane
GO:0006468 P protein phosphorylation
GO:0007030 P Golgi organization
GO:0007252 P I-kappaB phosphorylation
GO:0007616 P long-term memory
GO:0008285 P negative regulation of cell population proliferation
GO:0009950 P dorsal/ventral axis specification
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0018105 P peptidyl-serine phosphorylation
GO:0019992 F diacylglycerol binding
GO:0034389 P lipid droplet organization
GO:0035556 P intracellular signal transduction
GO:0040018 P positive regulation of multicellular organism growth
GO:0045471 P response to ethanol
GO:0046872 F metal ion binding
GO:0048812 P neuron projection morphogenesis
GO:0090277 P positive regulation of peptide hormone secretion
RNA-seq EntryA_TrvaFAMAMG_TR10669c2_g2_i1
Sequence
(Amino Acid)
YRDLKLDNILLDSDGHCKLADFGMCKEGIIDGATTTTFCGTPDYIAPEILQEQEYGCSVD
WWALGVLLYEMLAGQPPFEADNEDDLFESILHDDVLYPVWLSRDSVSILKGFMTKVPSRR
LGVCGGPSGIKPPIPSPSC
(45 a.a.)

- SilkBase 1999-2023 -