SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG11359_internal:A_TrvaFAMAMG_TR10548c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		AF245662_1_ABC_transporter_protein_white_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0004888 F transmembrane signaling receptor activity
GO:0005395 F obsolete eye pigment precursor transporter activity
GO:0005524 F ATP binding
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006727 P ommochrome biosynthetic process
GO:0006810 P transport
GO:0006856 P eye pigment precursor transport
GO:0007165 P signal transduction
GO:0007613 P memory
GO:0008049 P male courtship behavior
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016887 F ATP hydrolysis activity
GO:0031409 F pigment binding
GO:0031410 C cytoplasmic vesicle
GO:0042332 P gravitaxis
GO:0042401 P cellular biogenic amine biosynthetic process
GO:0042441 P eye pigment metabolic process
GO:0042626 F ATPase-coupled transmembrane transporter activity
GO:0048072 P compound eye pigmentation
GO:0055085 P transmembrane transport
GO:0070731 P cGMP transport
RNA-seq EntryA_TrvaFAMAMG_TR10548c0_g1_i1
Sequence
(Amino Acid)
DKLLIMADGRVAFLGSPDQAFTFFKELGAACPANYNPADHFIQLLAGVPGREEVTRHTID
TVCTSFAKSEIGCRIAAEAENALFNERKIQAGLLDAPWTT
(32 a.a.)

- SilkBase 1999-2023 -