SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG11355_complete:A_TrvaFAMAMG_TR10542c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		thioredoxin_peroxidase_[Bombyx_mori]
Ontology
GO:0000302 P response to reactive oxygen species
GO:0001893 P maternal placenta development
GO:0004601 F peroxidase activity
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005759 C mitochondrial matrix
GO:0005769 C early endosome
GO:0005829 C cytosol
GO:0006915 P apoptotic process
GO:0006979 P response to oxidative stress
GO:0007005 P mitochondrion organization
GO:0008022 F protein C-terminus binding
GO:0008284 P positive regulation of cell population proliferation
GO:0008379 F thioredoxin peroxidase activity
GO:0008385 C IkappaB kinase complex
GO:0008785 F alkyl hydroperoxide reductase activity
GO:0016209 F antioxidant activity
GO:0016491 F oxidoreductase activity
GO:0018171 P peptidyl-cysteine oxidation
GO:0019900 F kinase binding
GO:0019901 F protein kinase binding
GO:0030099 P myeloid cell differentiation
GO:0032496 P response to lipopolysaccharide
GO:0033673 P negative regulation of kinase activity
GO:0034599 P cellular response to oxidative stress
GO:0034614 P cellular response to reactive oxygen species
GO:0042542 P response to hydrogen peroxide
GO:0042744 P hydrogen peroxide catabolic process
GO:0042802 F identical protein binding
GO:0043027 F cysteine-type endopeptidase inhibitor activity involved in apoptotic process
GO:0043066 P negative regulation of apoptotic process
GO:0043154 P negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0043209 C myelin sheath
GO:0051092 P positive regulation of NF-kappaB transcription factor activity
GO:0051881 P regulation of mitochondrial membrane potential
GO:0051920 F peroxiredoxin activity
GO:0055114 P obsolete oxidation-reduction process
GO:0070062 C extracellular exosome
GO:0098869 P cellular oxidant detoxification
RNA-seq EntryA_TrvaFAMAMG_TR10542c0_g1_i1
Sequence
(Amino Acid)
MSNFVRQITQRVLSPTYNAAKRINFSTTSAVFGPKVQKPAPEFSATAVVNGEFNQLKLSD
FSGKYVVLFFYPLDFTFVCPTEIIAFSERAKEFAGIECQVIGVSTDSEFSHLAWINTPRK
DGGLGKMEIPLLSDYKKQISQDYDVLLDDGFALRGLFIIDRSGVLRHMSVNDLPVGRSVD
ETLRLVKAFQFADKHGEVCPANWNPESNAATIKPTPADSKQYFQNSN
*(75 a.a.)

- SilkBase 1999-2023 -