| Name | O_TrvaFAMAMG11316_internal:A_TrvaFAMAMG_TR10468c0_g1_i1 |
| Scaffold_id | |
NCBI non-redundant (nr) | putative_CBR-EAT-6_protein_[Operophtera_brumata] |
| Ontology |
| GO:0000166 |
F |
nucleotide binding |
| GO:0005391 |
F |
P-type sodium:potassium-exchanging transporter activity |
| GO:0005524 |
F |
ATP binding |
| GO:0005886 |
C |
plasma membrane |
| GO:0006810 |
P |
transport |
| GO:0006811 |
P |
ion transport |
| GO:0006813 |
P |
potassium ion transport |
| GO:0006814 |
P |
sodium ion transport |
| GO:0008152 |
P |
metabolic process |
| GO:0010248 |
P |
establishment or maintenance of transmembrane electrochemical gradient |
| GO:0016020 |
C |
membrane |
| GO:0016021 |
C |
integral component of membrane |
| GO:0016787 |
F |
hydrolase activity |
| GO:0046872 |
F |
metal ion binding |
| GO:0090662 |
P |
transmembrane transport |
|
| RNA-seq Entry | A_TrvaFAMAMG_TR10468c0_g1_i1 |
Sequence (Amino Acid) | LTPGQLEVVYRTNVVSGLSDGFAKELLALHGQNALKELKGTSYWKLLRHNLFGWFQCVLW
IGAILNFIAFLSTAEIDTGSTKGSPKEYLYLGSIIVATVVGTGFFGFYQEAK
(36 a.a.) |