SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG11278_complete:A_TrvaFAMAMG_TR10294c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_cytoplasmic_protein_NCK1_isoform_X2_[Papilio_polytes]
Ontology
GO:0000164 C protein phosphatase type 1 complex
GO:0004860 F protein kinase inhibitor activity
GO:0005086 F guanyl-nucleotide exchange factor activity
GO:0005102 F signaling receptor binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005783 C endoplasmic reticulum
GO:0005802 C trans-Golgi network
GO:0005840 C ribosome
GO:0005886 C plasma membrane
GO:0005911 C cell-cell junction
GO:0006417 P regulation of translation
GO:0006469 P negative regulation of protein kinase activity
GO:0006930 P substrate-dependent cell migration, cell extension
GO:0007015 P actin filament organization
GO:0010976 P positive regulation of neuron projection development
GO:0012506 C vesicle membrane
GO:0016192 P vesicle-mediated transport
GO:0016477 P cell migration
GO:0019904 F protein domain specific binding
GO:0030032 P lamellipodium assembly
GO:0030334 P regulation of cell migration
GO:0030838 P positive regulation of actin filament polymerization
GO:0030971 F receptor tyrosine kinase binding
GO:0033137 P negative regulation of peptidyl-serine phosphorylation
GO:0036493 P positive regulation of translation in response to endoplasmic reticulum stress
GO:0042102 P positive regulation of T cell proliferation
GO:0042110 P T cell activation
GO:0043547 P positive regulation of GTPase activity
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046875 F ephrin receptor binding
GO:0048013 P ephrin receptor signaling pathway
GO:0051707 P response to other organism
GO:0060548 P negative regulation of cell death
GO:0070262 P peptidyl-serine dephosphorylation
GO:0071074 F eukaryotic initiation factor eIF2 binding
GO:1902237 P positive regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway
GO:1903676 P positive regulation of cap-dependent translational initiation
GO:1903679 P positive regulation of cap-independent translational initiation
GO:1903898 P negative regulation of PERK-mediated unfolded protein response
GO:1903912 P negative regulation of endoplasmic reticulum stress-induced eIF2 alpha phosphorylation
GO:1904030 P negative regulation of cyclin-dependent protein kinase activity
GO:1990441 P negative regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress
RNA-seq EntryA_TrvaFAMAMG_TR10294c0_g1_i1
Sequence
(Amino Acid)
MLETRSVRAADSVWASKPLPAPNAMANTRHGKNAQDDVCYVVAKYDYAAQGAQELDLRKN
ERYLLLDDSKHWWRVQNARSQSGYVPSNYVKKEKPSLFDSIKKKVKKGSGSKTLPSNSSP
VRGAESPGTARRAEPGDALGAALVKYNYQAQQPDELSLTKGTRILILEKSNDGWWRGQYQ
SHTGWFPSNYTSEEGDNEDSVHTYAMAENVLDIVVALYSFTSNNEQELSFEKGDRLEIIE
RPPSDPEWYRARDHRGRLGLVPRNYLQELGEYLAVPYAERPAERPAERPAERPSERAWYY
GAITRTHCDALLNQHGHDGDFLIRDSETNAGDYSVSLKAPARNKHFRVHVEGGAYCIGQR
KFPSLELLVAHYQRAPIYTNKHGEKLYLVRPLPRPALC
*(132 a.a.)

- SilkBase 1999-2023 -