SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG1125_3prime_partial:A_TrvaFAMAMG_TR1956c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_intraflagellar_transport_protein_88_homolog_[Amyelois_transitella]
Ontology
GO:0001654 P eye development
GO:0001822 P kidney development
GO:0001889 P liver development
GO:0002080 C acrosomal membrane
GO:0002081 C outer acrosomal membrane
GO:0003382 P epithelial cell morphogenesis
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005802 C trans-Golgi network
GO:0005813 C centrosome
GO:0005814 C centriole
GO:0005856 C cytoskeleton
GO:0005929 C cilium
GO:0005930 C axoneme
GO:0007219 P Notch signaling pathway
GO:0007224 P smoothened signaling pathway
GO:0007288 P sperm axoneme assembly
GO:0007290 P spermatid nucleus elongation
GO:0007368 P determination of left/right symmetry
GO:0007399 P nervous system development
GO:0007420 P brain development
GO:0007507 P heart development
GO:0008104 P protein localization
GO:0008544 P epidermis development
GO:0008589 P regulation of smoothened signaling pathway
GO:0009887 P animal organ morphogenesis
GO:0009952 P anterior/posterior pattern specification
GO:0009953 P dorsal/ventral pattern formation
GO:0019894 F kinesin binding
GO:0021513 P spinal cord dorsal/ventral patterning
GO:0021537 P telencephalon development
GO:0030030 P cell projection organization
GO:0030324 P lung development
GO:0030992 C intraciliary transport particle B
GO:0031016 P pancreas development
GO:0031122 P cytoplasmic microtubule organization
GO:0031512 C motile cilium
GO:0032391 C photoreceptor connecting cilium
GO:0034405 P response to fluid shear stress
GO:0035058 P non-motile cilium assembly
GO:0036064 C ciliary basal body
GO:0036334 P epidermal stem cell homeostasis
GO:0042384 P cilium assembly
GO:0042487 P regulation of odontogenesis of dentin-containing tooth
GO:0042733 P embryonic digit morphogenesis
GO:0042995 C cell projection
GO:0043568 P positive regulation of insulin-like growth factor receptor signaling pathway
GO:0045177 C apical part of cell
GO:0045598 P regulation of fat cell differentiation
GO:0048853 P forebrain morphogenesis
GO:0050680 P negative regulation of epithelial cell proliferation
GO:0055007 P cardiac muscle cell differentiation
GO:0060021 P roof of mouth development
GO:0060091 C kinocilium
GO:0060122 P inner ear receptor cell stereocilium organization
GO:0060173 P limb development
GO:0060259 P regulation of feeding behavior
GO:0060271 P cilium assembly
GO:0060411 P cardiac septum morphogenesis
GO:0060426 P lung vasculature development
GO:0060914 P heart formation
GO:0061351 P neural precursor cell proliferation
GO:0070613 P regulation of protein processing
GO:0072372 C cilium
GO:0090102 P cochlea development
GO:0097541 C axonemal basal plate
GO:0097542 C ciliary tip
GO:0097546 C ciliary base
GO:1902017 P regulation of cilium assembly
GO:2000785 P regulation of autophagosome assembly
RNA-seq EntryA_TrvaFAMAMG_TR1956c0_g1_i1
Sequence
(Amino Acid)
MLSSRYYSASRLGTDAKPRTAIVVDEDDELYSGFNDVAPALDTRNLREDETFQETVRTAG
IGRKLPSRTGTGMVRLGTVSMRDVGSRSGTSARPVTALRAAGYTSASRDRPVPTQPLEDS
VEDRVKQMEGRIMALVEESCLLSARPDPDDDGSVKKEQDLSQALAKAQEASTMERQLIRM
QEQANLGDTHNLDLTFAVLCNLADQYALNEMYTEALNTYQLLTRNKLFPHANRLKVNMGN
IYFKMGEHPKALKLYRMALDQTPTAEKDLRMKVMHNIGLLLVRMGKFRDAVTNFQHIMHE
QGDFQTGLHLVLCSVALNDPEGGKAAFHAMLDVEPPTYHHDIPIDDEKDAYECVVRDVSR
GDKLSRWSRRAAADAERCLALAAAVLTPATATDDDSGGMSWCVEALRGYSGGAAGARLEL
GAALSSLRTLRAGPH
(144 a.a.)

- SilkBase 1999-2023 -