SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaFAMAMG11216_internal:A_TrvaFAMAMG_TR10059c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_protocadherin-like_wing_polarity_protein_stan_[Bombyx_mori]
Ontology
GO:0001736 P establishment of planar polarity
GO:0001738 P morphogenesis of a polarized epithelium
GO:0004871 F obsolete signal transducer activity
GO:0004872 F signaling receptor activity
GO:0004888 F transmembrane signaling receptor activity
GO:0004930 F G protein-coupled receptor activity
GO:0005057 F obsolete signal transducer activity, downstream of receptor
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0005911 C cell-cell junction
GO:0007155 P cell adhesion
GO:0007156 P homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007164 P establishment of tissue polarity
GO:0007165 P signal transduction
GO:0007166 P cell surface receptor signaling pathway
GO:0007186 P G protein-coupled receptor signaling pathway
GO:0007275 P multicellular organism development
GO:0007367 P segment polarity determination
GO:0007409 P axonogenesis
GO:0007411 P axon guidance
GO:0007464 P R3/R4 cell fate commitment
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016055 P Wnt signaling pathway
GO:0016318 P ommatidial rotation
GO:0016319 P mushroom body development
GO:0016339 P calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules
GO:0016358 P dendrite development
GO:0019233 P sensory perception of pain
GO:0030177 P positive regulation of Wnt signaling pathway
GO:0030178 P negative regulation of Wnt signaling pathway
GO:0035159 P regulation of tube length, open tracheal system
GO:0042067 P establishment of ommatidial planar polarity
GO:0045746 P negative regulation of Notch signaling pathway
GO:0045773 P positive regulation of axon extension
GO:0048057 P R3/R4 development
GO:0048813 P dendrite morphogenesis
GO:0050770 P regulation of axonogenesis
GO:0050839 F cell adhesion molecule binding
GO:0051963 P regulation of synapse assembly
GO:0070593 P dendrite self-avoidance
GO:0090175 P regulation of establishment of planar polarity
GO:1902669 P positive regulation of axon guidance
RNA-seq EntryA_TrvaFAMAMG_TR10059c0_g1_i1
Sequence
(Amino Acid)
LVSSQYNVLSTAYPWSDAMFEDFVSRNRSRVKRSHSLVPFDMAIDVKIAEAKQWISETYA
SFAIPTTDRWQGICLRQSQFVNSLTAFLPRTVQKMCKVQFLDVSDPRFMIESSQGDLVAT
DDICIQEPMWKVSILFTFNCDQTNI
(47 a.a.)

- SilkBase 1999-2023 -