SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaFAMAMG11198_complete:A_TrvaFAMAMG_TR10009c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
myosin_light_polypeptide_9_isoform_B_[Bombyx_mori]
Ontology
GO:0000281 P mitotic cytokinesis
GO:0001736 P establishment of planar polarity
GO:0003384 P apical constriction involved in gastrulation
GO:0005509 F calcium ion binding
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0005911 C cell-cell junction
GO:0005912 C adherens junction
GO:0005938 C cell cortex
GO:0007298 P border follicle cell migration
GO:0007300 P ovarian nurse cell to oocyte transport
GO:0016324 C apical plasma membrane
GO:0016459 C myosin complex
GO:0016460 C myosin II complex
GO:0019749 P cytoskeleton-dependent cytoplasmic transport, nurse cell to oocyte
GO:0022008 P neurogenesis
GO:0030048 P actin filament-based movement
GO:0030496 C midbody
GO:0030707 P ovarian follicle cell development
GO:0031036 P myosin II filament assembly
GO:0031941 C filamentous actin
GO:0032036 F myosin heavy chain binding
GO:0032154 C cleavage furrow
GO:0032956 P regulation of actin cytoskeleton organization
GO:0035148 P tube formation
GO:0035159 P regulation of tube length, open tracheal system
GO:0035183 C female germline ring canal inner rim
GO:0035191 P nuclear axial expansion
GO:0035277 P spiracle morphogenesis, open tracheal system
GO:0035317 P imaginal disc-derived wing hair organization
GO:0042060 P wound healing
GO:0045177 C apical part of cell
GO:0046872 F metal ion binding
GO:0048471 C perinuclear region of cytoplasm
GO:0051233 C spindle midzone
GO:0060288 P formation of a compartment boundary
GO:0090254 P cell elongation involved in imaginal disc-derived wing morphogenesis
RNA-seq EntryA_TrvaFAMAMG_TR10009c0_g1_i1
Sequence
(Amino Acid)
MSSRKTAGRRINKKRAQRATSNVFAMFDQAQIAEFKEAFNMIDQNRDGFIDKDDLHDMLA
SLGKNPTEDYLEGMMNEAPGPINFTMFLTLFGERLQGTDPEDVIKNAFGCFDEENNGVIG
EERLRELLTTMGDRFTDDDVDEMLREAPIRDGLFDYVEFTRILKHGAKDKDEQ
*(57 a.a.)

- SilkBase 1999-2023 -