EntryView

ORF from Assembled RNA_seq Entry

Name

O_TrvaFAMAMG11196_internal:A_TrvaFAMAMG_TR10004c0_g1_i1

Scaffold_id

NCBI non-redundant
(nr)

PREDICTED:_runt-related_transcription_factor_3_isoform_X1_[Bombyx_mori]

Ontology

GO:0000122	P	negative regulation of transcription by RNA polymerase II
GO:0001709	P	cell fate determination
GO:0003677	F	DNA binding
GO:0003700	F	DNA-binding transcription factor activity
GO:0003705	F	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0005524	F	ATP binding
GO:0005634	C	nucleus
GO:0006351	P	transcription, DNA-templated
GO:0006355	P	regulation of transcription, DNA-templated
GO:0006952	P	defense response
GO:0007165	P	signal transduction
GO:0007275	P	multicellular organism development
GO:0007469	P	antennal development
GO:0007486	P	imaginal disc-derived female genitalia development
GO:0016360	P	sensory organ precursor cell fate determination
GO:0030097	P	hemopoiesis
GO:0030154	P	cell differentiation
GO:0035162	P	embryonic hemopoiesis
GO:0035163	P	embryonic hemocyte differentiation
GO:0035165	P	embryonic crystal cell differentiation
GO:0035168	P	larval lymph gland hemocyte differentiation
GO:0035170	P	lymph gland crystal cell differentiation
GO:0035211	P	spermathecum morphogenesis
GO:0035314	P	scab formation
GO:0042060	P	wound healing
GO:0042675	P	compound eye cone cell differentiation
GO:0042688	P	crystal cell differentiation
GO:0043565	F	sequence-specific DNA binding
GO:0044212	F	transcription cis-regulatory region binding
GO:0045165	P	cell fate commitment
GO:0045467	P	R7 cell development
GO:0045944	P	positive regulation of transcription by RNA polymerase II
GO:0046672	P	positive regulation of compound eye retinal cell programmed cell death
GO:0048477	P	oogenesis
GO:0048592	P	eye morphogenesis
GO:0048749	P	compound eye development

RNA-seq Entry

Sequence
(Amino Acid)

GTLVTVRAGNDENCCAELRNSSAVMKNQVAKFNDLRFVGRSGRGKSFTLTITISTTPPQV
TTYNKAIKVTVDGPREPRSKTMLSLLGQQQQFHFAFGQRPFPFPPDPLGGFRMP
(37 a.a.)

- SilkBase 1999-2023 -