SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG1090_complete:A_TrvaFAMAMG_TR1919c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_TNF_receptor-associated_factor_1_[Papilio_polytes]
Ontology
GO:0000151 C ubiquitin ligase complex
GO:0002726 P positive regulation of T cell cytokine production
GO:0004842 F ubiquitin-protein transferase activity
GO:0005102 F signaling receptor binding
GO:0005164 F tumor necrosis factor receptor binding
GO:0005174 F CD40 receptor binding
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005938 C cell cortex
GO:0006461 P protein-containing complex assembly
GO:0006915 P apoptotic process
GO:0007165 P signal transduction
GO:0007250 P activation of NF-kappaB-inducing kinase activity
GO:0008270 F zinc ion binding
GO:0008289 F lipid binding
GO:0009898 C cytoplasmic side of plasma membrane
GO:0012506 C vesicle membrane
GO:0016567 P protein ubiquitination
GO:0016874 F ligase activity
GO:0019899 F enzyme binding
GO:0019901 F protein kinase binding
GO:0019903 F protein phosphatase binding
GO:0030163 P protein catabolic process
GO:0031435 F mitogen-activated protein kinase kinase kinase binding
GO:0031625 F ubiquitin protein ligase binding
GO:0031996 F thioesterase binding
GO:0032403 F protein-containing complex binding
GO:0032743 P positive regulation of interleukin-2 production
GO:0033209 P tumor necrosis factor-mediated signaling pathway
GO:0034351 P negative regulation of glial cell apoptotic process
GO:0035631 C CD40 receptor complex
GO:0042802 F identical protein binding
GO:0042981 P regulation of apoptotic process
GO:0043066 P negative regulation of apoptotic process
GO:0043123 P positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0043234 C protein-containing complex
GO:0043507 P positive regulation of JUN kinase activity
GO:0043623 P protein-containing complex assembly
GO:0045121 C membrane raft
GO:0046328 P regulation of JNK cascade
GO:0046625 F sphingolipid binding
GO:0046872 F metal ion binding
GO:0051023 P regulation of immunoglobulin production
GO:0051091 P positive regulation of DNA-binding transcription factor activity
GO:0051092 P positive regulation of NF-kappaB transcription factor activity
GO:0051291 P protein heterooligomerization
GO:0051865 P protein autoubiquitination
GO:0070207 P protein homotrimerization
GO:0070534 P protein K63-linked ubiquitination
GO:0071732 P cellular response to nitric oxide
GO:0090073 P positive regulation of protein homodimerization activity
GO:0097057 C TRAF2-GSTP1 complex
GO:0097300 P programmed necrotic cell death
GO:1903265 P positive regulation of tumor necrosis factor-mediated signaling pathway
GO:1903721 P positive regulation of I-kappaB phosphorylation
GO:1990597 C AIP1-IRE1 complex
GO:1990604 C IRE1-TRAF2-ASK1 complex
GO:2001238 P positive regulation of extrinsic apoptotic signaling pathway
RNA-seq EntryA_TrvaFAMAMG_TR1919c0_g1_i1
Sequence
(Amino Acid)
MSLNRVSVNGLSVSKSSQESPCYFCNELFEMGQLQNHLKLCGSILEQCPLRCGAWIQRKH
KETHVKECPQMEKARNSTSPSHASMPAPTPPVMSTHTWTPRPVPLEDCVSYLEKEVANIK
LVLTEESSQRDVQSTEVETVRSKLVLVEERTQHFLSTLVSLRAAVDDEASRSANWAAQFK
HDLANIQIALQELQSQQLSTAMRLESTVSSLVHEQNERELLEQALTQHDTRIRAVYKLEE
VIDYLKRTVEEERLRNEEMRVTLEAELVEARRSSEHVAQLSALRDQVQNIGTERPSIDRL
AVLEVATADARAEAAEHATRMDIVSRDLRALTKSYHKLRTELADFQAKITFNQHEMGSDN
GHFIWRIDSFTTRMKDSKANDTVLSSPIFRTHKYGYTLKVGPV
*(133 a.a.)

- SilkBase 1999-2023 -