SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG10593_internal:A_TrvaFAMAMG_TR9880c0_g4_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_serine/threonine-protein_phosphatase_6_regulatory_ankyrin_repeat_subunit_A_[Bombyx_mori]
Ontology
GO:0000012 P single strand break repair
GO:0000139 C Golgi membrane
GO:0002121 P inter-male aggressive behavior
GO:0002124 P territorial aggressive behavior
GO:0003684 F damaged DNA binding
GO:0005216 F ion channel activity
GO:0005262 F calcium channel activity
GO:0005515 F protein binding
GO:0005516 F calmodulin binding
GO:0005634 C nucleus
GO:0005635 C nuclear envelope
GO:0005789 C endoplasmic reticulum membrane
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006816 P calcium ion transport
GO:0006828 P manganese ion transport
GO:0007204 P positive regulation of cytosolic calcium ion concentration
GO:0007340 P acrosome reaction
GO:0008050 P female courtship behavior
GO:0010468 P regulation of gene expression
GO:0012505 C endomembrane system
GO:0015279 F store-operated calcium channel activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0019236 P response to pheromone
GO:0019992 F diacylglycerol binding
GO:0032590 C dendrite membrane
GO:0048047 P mating behavior, sex discrimination
GO:0055085 P transmembrane transport
GO:0070588 P calcium ion transmembrane transport
GO:0070679 F inositol 1,4,5 trisphosphate binding
GO:1902436 P negative regulation of male mating behavior
RNA-seq EntryA_TrvaFAMAMG_TR9880c0_g4_i1
Sequence
(Amino Acid)
FAASENHNDVLEYLLHKEHDTQSLMDDKRFVYNLMVCSKNHNNIPIEEFVLVSPAPVDTA
AKLSNIYINLSTKEKERAKDLIAAGKQCEAMATELLALAAGADSAGHILTATDNRNIEFL
DVLIENEQKEVIAHTVVQRYLQELWRGSLKWTGIKIMFLFFAFIICPPVWMVFSLPLGHR
YHKIPIIKFMSYLTAHIYLMVLLALVAITPIYNSIFRDSLIPRWYEWMLLISLSGLLLLE
LTN
(80 a.a.)

- SilkBase 1999-2023 -