SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG1049_complete:A_TrvaFAMAMG_TR1885c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		thymidylate_synthase_isoform_1_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0003729 F mRNA binding
GO:0004799 F thymidylate synthase activity
GO:0005542 F folic acid binding
GO:0005634 C nucleus
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005743 C mitochondrial inner membrane
GO:0005759 C mitochondrial matrix
GO:0006206 P pyrimidine nucleobase metabolic process
GO:0006231 P dTMP biosynthetic process
GO:0006235 P dTTP biosynthetic process
GO:0007568 P aging
GO:0007623 P circadian rhythm
GO:0008144 F obsolete drug binding
GO:0008168 F methyltransferase activity
GO:0009165 P nucleotide biosynthetic process
GO:0009636 P response to toxic substance
GO:0014070 P response to organic cyclic compound
GO:0016020 C membrane
GO:0016740 F transferase activity
GO:0019088 P transformation of host cell by virus
GO:0019860 P uracil metabolic process
GO:0031100 P animal organ regeneration
GO:0032259 P methylation
GO:0032570 P response to progesterone
GO:0033189 P response to vitamin A
GO:0034097 P response to cytokine
GO:0035999 P tetrahydrofolate interconversion
GO:0042493 P response to xenobiotic stimulus
GO:0042803 F protein homodimerization activity
GO:0045471 P response to ethanol
GO:0046078 P dUMP metabolic process
GO:0046653 P tetrahydrofolate metabolic process
GO:0046683 P response to organophosphorus
GO:0048037 F obsolete cofactor binding
GO:0048589 P developmental growth
GO:0051216 P cartilage development
GO:0051384 P response to glucocorticoid
GO:0051593 P response to folic acid
GO:0060574 P intestinal epithelial cell maturation
RNA-seq EntryA_TrvaFAMAMG_TR1885c0_g1_i1
Sequence
(Amino Acid)
MVNDNGIDVVKAHEEYQYLNLIRQIIETGDKRVDRTGVGTLSIFGAMQRYSLQNKTLPLL
TTKRVFTRGVIEELLWMISGSTDSKALAAKGVHIWDANGSRSFLDNLGFTDREEGDLGPV
YGFQWRHSGAEYIDCKTDYTGQGIDQIQNIINSIKKNPSDRRMLVCAWNPSNLNKMALPP
CHCLAQFYVANGKLSCLLYQRSADMGLGVPFNIASYSLLTHMIAHVTGYEAGEFIHTTGD
THVYLNHIEPLKTQLEREPRLFPTLEFVRKIECIDDFKFEDFIIKDYKPHPKIEMEMAV
*(99 a.a.)

- SilkBase 1999-2023 -