SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG10456_internal:A_TrvaFAMAMG_TR9866c9_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_protein_still_life,_isoform_SIF_type_1_[Bombyx_mori]
Ontology
GO:0005057 F obsolete signal transducer activity, downstream of receptor
GO:0005085 F guanyl-nucleotide exchange factor activity
GO:0005089 F guanyl-nucleotide exchange factor activity
GO:0005622 C intracellular anatomical structure
GO:0007165 P signal transduction
GO:0007268 P chemical synaptic transmission
GO:0007275 P multicellular organism development
GO:0030036 P actin cytoskeleton organization
GO:0030054 C cell junction
GO:0030676 F guanyl-nucleotide exchange factor activity
GO:0035023 P regulation of Rho protein signal transduction
GO:0035556 P intracellular signal transduction
GO:0043087 P regulation of GTPase activity
GO:0043547 P positive regulation of GTPase activity
GO:0045202 C synapse
GO:0050770 P regulation of axonogenesis
GO:0050803 P regulation of synapse structure or activity
GO:0051491 P positive regulation of filopodium assembly
RNA-seq EntryA_TrvaFAMAMG_TR9866c9_g1_i1
Sequence
(Amino Acid)
SQRRGVGVGAAPSGYPGRGLYLELGGGERDLSPPSDNVMFDNQCYATTPSSSNGNSDQEP
CQRRDSRQHHHPKPCLSRQASQSSTTPAPGSPTSRLLLEYEMHLRNTLAKGMDAESYSLH
TFEALCSQSMEDLERENLPSSNQRSPYPSRRRPSSQCS
(51 a.a.)

- SilkBase 1999-2023 -