SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaFAMAMG10270_5prime_partial:A_TrvaFAMAMG_TR9853c0_g1_i7
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_voltage-dependent_calcium_channel_type_A_subunit_alpha-1_isoform_X1_[Bombyx_mori]
Ontology
GO:0002027 P regulation of heart rate
GO:0005216 F ion channel activity
GO:0005244 F voltage-gated ion channel activity
GO:0005245 F voltage-gated calcium channel activity
GO:0005262 F calcium channel activity
GO:0005509 F calcium ion binding
GO:0005891 C voltage-gated calcium channel complex
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006816 P calcium ion transport
GO:0006887 P exocytosis
GO:0006914 P autophagy
GO:0007268 P chemical synaptic transmission
GO:0007269 P neurotransmitter secretion
GO:0007275 P multicellular organism development
GO:0007602 P phototransduction
GO:0007619 P courtship behavior
GO:0007632 P visual behavior
GO:0008331 F high voltage-gated calcium channel activity
GO:0008332 F low voltage-gated calcium channel activity
GO:0008344 P adult locomotory behavior
GO:0010524 P positive regulation of calcium ion transport into cytosol
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016057 P regulation of membrane potential in photoreceptor cell
GO:0016323 C basolateral plasma membrane
GO:0016324 C apical plasma membrane
GO:0034765 P regulation of ion transmembrane transport
GO:0042045 P epithelial fluid transport
GO:0045433 P male courtship behavior, veined wing generated song production
GO:0045887 P positive regulation of synaptic assembly at neuromuscular junction
GO:0046872 F metal ion binding
GO:0046928 P regulation of neurotransmitter secretion
GO:0048786 C presynaptic active zone
GO:0050908 P detection of light stimulus involved in visual perception
GO:0055085 P transmembrane transport
GO:0070050 P neuron cellular homeostasis
GO:0070588 P calcium ion transmembrane transport
GO:0086010 P membrane depolarization during action potential
GO:0097352 P autophagosome maturation
RNA-seq EntryA_TrvaFAMAMG_TR9853c0_g1_i7
Sequence
(Amino Acid)
FFNYSRHFITKWQYYKQSDDYADILKYSNMGFTGMFSVETVLKIIAYGVKNFFKDPWNTF
DFITVIGSIIDALIMEFGENTFNVGFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALP
YVCLLIAMLFFIYAIIGMQVFGNIELTPEVDINRHNNFQSFIQALMLLFRCATGESWPNI
MLACLKPAKCDERAGKPPNEECGSTLAYAYFVSFIFFCSFLMLNLFVAVIMDNFDYLTRD
SSILGAHHLDEFVRIWAEYDPNATGKIHYTEMYDMLKNMDPPLGFGNKCPNRLAYKKLIR
MNMPLDDEGKVNFTTTLFALIRENLNIKMRSAEEMDQADEELRETITHIWPLQSKKMLDL
LVPRNDVLNQGKLTVGKIYAGLLILESWRSTRFGQTEPRGDQAYNENSPTAIQPVVFIYF
TERRPKFFLHYF
*(143 a.a.)

- SilkBase 1999-2023 -