SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_TrvaFAMAMG1020_complete:A_TrvaFAMAMG_TR1749c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_TFIIH_basal_transcription_factor_complex_helicase_XPD_subunit_isoform_X1_[Papilio_xuthus]
Ontology
GO:0000166 F nucleotide binding
GO:0000439 C transcription factor TFIIH core complex
GO:0001666 P response to hypoxia
GO:0001701 P in utero embryonic development
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0004003 F DNA helicase activity
GO:0004386 F helicase activity
GO:0004672 F protein kinase activity
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005675 C transcription factor TFIIH holo complex
GO:0005737 C cytoplasm
GO:0005819 C spindle
GO:0005856 C cytoskeleton
GO:0006139 P nucleobase-containing compound metabolic process
GO:0006281 P DNA repair
GO:0006283 P transcription-coupled nucleotide-excision repair
GO:0006289 P nucleotide-excision repair
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0006468 P protein phosphorylation
GO:0006915 P apoptotic process
GO:0006974 P cellular response to DNA damage stimulus
GO:0006979 P response to oxidative stress
GO:0007059 P chromosome segregation
GO:0007568 P aging
GO:0008022 F protein C-terminus binding
GO:0008026 F helicase activity
GO:0008094 F ATP-dependent activity, acting on DNA
GO:0008283 P cell population proliferation
GO:0008353 F RNA polymerase II CTD heptapeptide repeat kinase activity
GO:0009411 P response to UV
GO:0009650 P UV protection
GO:0009791 P post-embryonic development
GO:0016787 F hydrolase activity
GO:0016818 F hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
GO:0019907 C cyclin-dependent protein kinase activating kinase holoenzyme complex
GO:0021510 P spinal cord development
GO:0022405 P hair cycle process
GO:0030198 P extracellular matrix organization
GO:0030282 P bone mineralization
GO:0032289 P central nervous system myelin formation
GO:0032508 P DNA duplex unwinding
GO:0033683 P nucleotide-excision repair, DNA incision
GO:0035264 P multicellular organism growth
GO:0035315 P hair cell differentiation
GO:0040016 P embryonic cleavage
GO:0043139 F 5'-3' DNA helicase activity
GO:0043249 P erythrocyte maturation
GO:0043388 P positive regulation of DNA binding
GO:0043588 P skin development
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0047485 F protein N-terminus binding
GO:0048820 P hair follicle maturation
GO:0051536 F iron-sulfur cluster binding
GO:0051539 F 4 iron, 4 sulfur cluster binding
GO:0060218 P hematopoietic stem cell differentiation
GO:0071817 C MMXD complex
GO:1901990 P regulation of mitotic cell cycle phase transition
RNA-seq EntryA_TrvaFAMAMG_TR1749c0_g1_i1
Sequence
(Amino Acid)
MKLTVDGLLVYFPYDYIYPEQYAYMLELKRALDAKGHGLLEMPSGTGKTISLLSLIVAYM
IQNPHNVRKLIYCSRTLPEIEKVLEELKNLFDYYEKSQGEKPNLTGVVLSSRKNLCIHPE
VSREREGKLVDGKCHALTASYIRERHESDSSVPICQFYEGFNREGKESMLPYGVYTMDDM
KQYGADRNWCPYFLARFAIIHAEIVVYSYHYLLDPKIAEVVSKELNKEAVVVFDEAHNID
NVCIDSLSVKITRRTIDKSTQALQQLEKTVAQIREDDATRLTMEYEQLVAGLKDAAVQRE
TDTILGNPILPDEVLNEVVPGNIRNAEHFLSFLKRFIEYVKMRLRIQHVVQESPAGFLKD
VSSRVCIDRKPLRFCASRLSSLLRTLQLPDPSHLSSLVLITHLATLVSTYTKGFTIIIEP
FDDKTPNVSNPILHFSCMDSSIAMRPVFARFQTVIITSGTLSPLDMYPKILDFNPVIMSS
LTMTLARPCILPMIVSKGSDQVAISSKYETREDVAVIRNYGQLLVEISACVPDGVVCFFT
SYLYLESVVGAWYDQGVVASLQRHKLLFIETQDSAETSFALINYIKACESGRGAVLLSVA
RGKVSEGVDFQHHLGRAVLMFGIPYVFTQSRILKARLDYLREHFQIRENDFLTFDAMRHA
AQCVGRALRGKTDYGIMIFADKRFSRSDKRGKLPRWIQEHLRDSLANLSTEEAVQICKRW
LRQMAQPFTREDQLGVSLLTLQQLQSQEQQDKIEKQVILK
*(252 a.a.)

- SilkBase 1999-2023 -