SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_TrvaFAMAMG1001_5prime_partial:A_TrvaFAMAMG_TR1630c0_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_raf_kinase,_effector_of_Ras_isoform_X1_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0002168 P instar larval development
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0005057 F obsolete signal transducer activity, downstream of receptor
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0006468 P protein phosphorylation
GO:0007165 P signal transduction
GO:0007173 P epidermal growth factor receptor signaling pathway
GO:0007283 P spermatogenesis
GO:0007298 P border follicle cell migration
GO:0007362 P terminal region determination
GO:0007369 P gastrulation
GO:0007428 P primary branching, open tracheal system
GO:0007472 P wing disc morphogenesis
GO:0007476 P imaginal disc-derived wing morphogenesis
GO:0007552 P metamorphosis
GO:0008069 P dorsal/ventral axis specification, ovarian follicular epithelium
GO:0008284 P positive regulation of cell population proliferation
GO:0008293 P torso signaling pathway
GO:0008586 P imaginal disc-derived wing vein morphogenesis
GO:0009267 P cellular response to starvation
GO:0016242 P negative regulation of macroautophagy
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0030097 P hemopoiesis
GO:0030641 P regulation of cellular pH
GO:0035171 P lamellocyte differentiation
GO:0035309 P wing and notum subfield formation
GO:0035556 P intracellular signal transduction
GO:0040014 P regulation of multicellular organism growth
GO:0042386 P hemocyte differentiation
GO:0046534 P positive regulation of photoreceptor cell differentiation
GO:0046579 P positive regulation of Ras protein signal transduction
GO:0046777 P protein autophosphorylation
GO:0046872 F metal ion binding
GO:0051726 P regulation of cell cycle
GO:0070374 P positive regulation of ERK1 and ERK2 cascade
GO:2001234 P negative regulation of apoptotic signaling pathway
RNA-seq EntryA_TrvaFAMAMG_TR1630c0_g1_i1
Sequence
(Amino Acid)
LPGLVGGARARSADESWKNALSPRESYDDWVIPADEILIGARIGSGSFGTVYKAHWHGPV
AVKTLNVKTPTPAQLQAFKNEVAVLRKTRHSNILLFMGCVSKPSLAIVTQWCEGSSLYQH
LHVIETLFPIVYLVDVARQTAQGMDYLHAKNIIHRDLKSNNIFLRDDWSVKIGDFGLATA
KVRWSESSSSGGVQWQQPTGSILWMAPEVIRMDEPAPYTFHSDVYSYGVVLYELMAGELP
YAHLNNKDQILWMVGRGRLRPDVRRLRRDAPAQLKRTFTECVAFDRAARPLFRQVLASME
AILRLVPKITRSRSDPTLSHPQPHAALDSLAYSCASPKTPVNFHFNTDTSFPAFYGLPVP
NQRHP
*(121 a.a.)

- SilkBase 1999-2023 -