| Name | O_SariMSG2718_internal:A_SariMSG_c12342_g1_i1 |
| Scaffold_id | |
NCBI non-redundant
(nr) | isocitrate_dehydrogenase,_partial_[Bombyx_mori] |
| Ontology |
| GO:0000287 |
F |
magnesium ion binding |
| GO:0004450 |
F |
isocitrate dehydrogenase (NADP+) activity |
| GO:0005739 |
C |
mitochondrion |
| GO:0006097 |
P |
glyoxylate cycle |
| GO:0006099 |
P |
tricarboxylic acid cycle |
| GO:0006102 |
P |
isocitrate metabolic process |
| GO:0006103 |
P |
2-oxoglutarate metabolic process |
| GO:0016491 |
F |
oxidoreductase activity |
| GO:0016616 |
F |
oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor |
| GO:0044351 |
P |
macropinocytosis |
| GO:0046872 |
F |
metal ion binding |
| GO:0051287 |
F |
NAD binding |
| GO:0055114 |
P |
obsolete oxidation-reduction process |
|
| RNA-seq Entry | A_SariMSG_c12342_g1_i1 |
Sequence
(Amino Acid) | ADQYKATDSVVPGAGTLELIFKPESGEIIKHVVHEYKGAGVALAMFNTDASIIDFAHSSF
KYALGRKYPLYLSTKNTILKKYDGRFKDIFQNIYDNEYKKQFEDAGIWYEH
(36 a.a.) |
