SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG2643_internal:A_SariMSG_c12135_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		LOW_QUALITY_PROTEIN:_low-density_lipoprotein_receptor-related_protein_2_[Bombyx_mori]
Ontology
GO:0003281 P ventricular septum development
GO:0004872 F signaling receptor activity
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005765 C lysosomal membrane
GO:0005768 C endosome
GO:0005783 C endoplasmic reticulum
GO:0005794 C Golgi apparatus
GO:0005903 C brush border
GO:0005905 C clathrin-coated pit
GO:0006766 P vitamin metabolic process
GO:0006897 P endocytosis
GO:0006898 P receptor-mediated endocytosis
GO:0007507 P heart development
GO:0008283 P cell population proliferation
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016324 C apical plasma membrane
GO:0017124 F SH3 domain binding
GO:0030139 C endocytic vesicle
GO:0030900 P forebrain development
GO:0031526 C brush border membrane
GO:0035904 P aorta development
GO:0043235 C receptor complex
GO:0045177 C apical part of cell
GO:0046872 F metal ion binding
GO:0060976 P coronary vasculature development
GO:0070062 C extracellular exosome
RNA-seq EntryA_SariMSG_c12135_g1_i1
Sequence
(Amino Acid)
KVDVFELDGRWHAVVLGSNLTSPADLALDPTLGLMFVADSSQIIRANMDGTHSRSIVSEA
AYKASGIAVDIIARRVFWCDSLLDYIETVDYDGNHRFLVLRGQQVPSPSRLALFEDRVYW
SDSTKQGISSVNKYGGSSSIQAIYKMKDIKDPKAITVIHSLKQTSVNNPCGNNNGGCSQM
CIVTALQNGGLGYRCACNIGY
(66 a.a.)

- SilkBase 1999-2023 -