SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariMSG2640_3prime_partial:A_SariMSG_c12128_g1_i2
Scaffold_id
NCBI non-redundant
(nr)
glycerol_kinase-like_isoform_X4_[Helicoverpa_armigera]
Ontology
GO:0000166 F nucleotide binding
GO:0004370 F glycerol kinase activity
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005741 C mitochondrial outer membrane
GO:0005829 C cytosol
GO:0005975 P carbohydrate metabolic process
GO:0006071 P glycerol metabolic process
GO:0006072 P glycerol-3-phosphate metabolic process
GO:0006641 P triglyceride metabolic process
GO:0009409 P response to cold
GO:0010033 P response to organic substance
GO:0016020 C membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0016773 F phosphotransferase activity, alcohol group as acceptor
GO:0019217 P regulation of fatty acid metabolic process
GO:0019563 P glycerol catabolic process
GO:0042393 F histone binding
GO:0042493 P response to xenobiotic stimulus
GO:0042593 P glucose homeostasis
GO:0045471 P response to ethanol
GO:0046167 P glycerol-3-phosphate biosynthetic process
GO:0070062 C extracellular exosome
RNA-seq EntryA_SariMSG_c12128_g1_i2
Sequence
(Amino Acid)
MPVREGAKKSLVGVIDDGTKTVRFVIFEAERSDELAAYQLDKTEVQPQEGWSEQDPLEIL
QNIKICAENAIDQLTELGYAKEDIVTLGITNQRETTIAWDKYTGEIGRAS
(35 a.a.)

- SilkBase 1999-2023 -