SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG2617_internal:A_SariMSG_c12083_g1_i2
Scaffold_id
NCBI non-redundant
(nr)		histone-lysine_N-methyltransferase_SETMAR_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000790 C chromatin
GO:0000977 F RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0002039 F p53 binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005694 C chromosome
GO:0005730 C nucleolus
GO:0006275 P regulation of DNA replication
GO:0006306 P DNA methylation
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0007130 P synaptonemal complex assembly
GO:0007281 P germ cell development
GO:0007286 P spermatid development
GO:0007616 P long-term memory
GO:0008168 F methyltransferase activity
GO:0008270 F zinc ion binding
GO:0009267 P cellular response to starvation
GO:0009566 P fertilization
GO:0010424 P DNA methylation on cytosine within a CG sequence
GO:0016279 F protein-lysine N-methyltransferase activity
GO:0016568 P chromatin organization
GO:0016571 P histone methylation
GO:0016740 F transferase activity
GO:0018024 F histone-lysine N-methyltransferase activity
GO:0018027 P peptidyl-lysine dimethylation
GO:0031667 P response to nutrient levels
GO:0032259 P methylation
GO:0034968 P histone lysine methylation
GO:0035265 P organ growth
GO:0035690 P cellular response to xenobiotic stimulus
GO:0044030 P regulation of DNA methylation
GO:0045471 P response to ethanol
GO:0046872 F metal ion binding
GO:0046974 F histone methyltransferase activity (H3-K9 specific)
GO:0046976 F histone methyltransferase activity (H3-K27 specific)
GO:0051567 P histone H3-K9 methylation
GO:0051569 P regulation of histone H3-K4 methylation
GO:0051570 P regulation of histone H3-K9 methylation
GO:0060992 P response to fungicide
GO:0070734 P histone H3-K27 methylation
GO:0070742 F C2H2 zinc finger domain binding
GO:1902902 P negative regulation of autophagosome assembly
GO:1990841 F promoter-specific chromatin binding
RNA-seq EntryA_SariMSG_c12083_g1_i2
Sequence
(Amino Acid)
YVRFVTALLYTFWVFHLIISDFFCIAFLITMNDNYTHTSDKVIYIDESIPGPYEDSAEFQ
ELIDTYNSQISSHCLCVDVCIYPKCECLLKTCSNNYTLIMQNGQYKYRINTSNKNPVIEC
NSRCSCSTECGNRLVQKGPLEGLVIKTCNINEKGLGLFASEFIPSGTFICEYAGELLTKS
QAVYRNNGIKGNSG
(63 a.a.)

- SilkBase 1999-2023 -