SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG2477_internal:A_SariMSG_c11790_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_cyclin-H_[Papilio_xuthus]
Ontology
GO:0000307 C cyclin-dependent protein kinase holoenzyme complex
GO:0003674 F molecular_function
GO:0005575 C cellular_component
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005675 C transcription factor TFIIH holo complex
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0006468 P protein phosphorylation
GO:0007049 P cell cycle
GO:0008094 F ATP-dependent activity, acting on DNA
GO:0008150 P biological_process
GO:0008353 F RNA polymerase II CTD heptapeptide repeat kinase activity
GO:0016301 F kinase activity
GO:0016538 F cyclin-dependent protein serine/threonine kinase regulator activity
GO:0019907 C cyclin-dependent protein kinase activating kinase holoenzyme complex
GO:0045737 P positive regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0070985 C transcription factor TFIIK complex
GO:1901409 P positive regulation of phosphorylation of RNA polymerase II C-terminal domain
RNA-seq EntryA_SariMSG_c11790_g1_i1
Sequence
(Amino Acid)
HPKEILATCVYLACKVEEFNVSIGQFVANIKGDRDKASDIILNNELLLMQQLNYHLTIHN
PFRPVEGFLIDIKTRCTMANPERLRSGIDEFLEKVFLTDACLLYAPSQIALAAVLHAASK
EQENLDNYVTDMLFRDAGPDKLAILIEAVRKIRSLVKMVESPARERVRVIEKKLDRCRNQ
ENNPDSEIYKRKIREVLDEDDMAHVSSSRMSLDTSGIS
(71 a.a.)

- SilkBase 1999-2023 -