SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariMSG2434_internal:A_SariMSG_c11690_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		NCK-interacting_protein_with_SH3_domain_isoform_X2_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0001726 C ruffle
GO:0004672 F protein kinase activity
GO:0004713 F protein tyrosine kinase activity
GO:0004715 F non-membrane spanning protein tyrosine kinase activity
GO:0005102 F signaling receptor binding
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006468 P protein phosphorylation
GO:0007169 P transmembrane receptor protein tyrosine kinase signaling pathway
GO:0009968 P negative regulation of signal transduction
GO:0010976 P positive regulation of neuron projection development
GO:0016020 C membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016477 P cell migration
GO:0016740 F transferase activity
GO:0031234 C extrinsic component of cytoplasmic side of plasma membrane
GO:0038083 P peptidyl-tyrosine autophosphorylation
GO:0038128 P ERBB2 signaling pathway
GO:0042127 P regulation of cell population proliferation
GO:0042503 P tyrosine phosphorylation of STAT protein
GO:0042506 P tyrosine phosphorylation of STAT protein
GO:0042517 P positive regulation of tyrosine phosphorylation of STAT protein
GO:0042802 F identical protein binding
GO:0042995 C cell projection
GO:0045087 P innate immune response
GO:0045742 P positive regulation of epidermal growth factor receptor signaling pathway
GO:0045787 P positive regulation of cell cycle
GO:0045926 P negative regulation of growth
GO:0046777 P protein autophosphorylation
GO:0060575 P intestinal epithelial cell differentiation
GO:0061099 P negative regulation of protein tyrosine kinase activity
GO:0071300 P cellular response to retinoic acid
RNA-seq EntryA_SariMSG_c11690_g1_i1
Sequence
(Amino Acid)
QNDDYEMLKALFDFEATLSKTLSFMEGDYFYLQQTNTKQRNWWHVVDRKGHVGFVPSNYV
ATVKVEPQFYLAFLNDCIRNLNENNATSQKQELINRLSEKKKQILISIKPHNKKPPAPKP
PPRFDESTPPNGVSPCFDLRPVVSQQHITEERELSPTKETNNGGTNNNEDLRKSVVLSKT
SHQLSSDTDTDSQGSNDNIR
(65 a.a.)

- SilkBase 1999-2023 -